#include <epan/prefs.h>
#include <epan/proto.h>
#include <string.h>
+#include <epan/dissectors/packet-frame.h>
#include "packet-infiniband.h"
+
+/* Protocol Registration */
void proto_register_infiniband(void)
{
if(proto_infiniband == -1)
}
+/* Reg Handoff. Register dissectors we'll need for IPoIB */
void proto_reg_handoff_infiniband(void)
{
static int initialized=FALSE;
if(!initialized)
{
infiniband_handle = create_dissector_handle(dissect_infiniband, proto_infiniband);
+ ipv6_handle = find_dissector("ipv6");
+ ip_handle = find_dissector("ip");
+ arp_handle = find_dissector("arp");
+ rarp_handle = find_dissector("rarp");
+ data_handle = find_dissector("data");
+ ethertype_dissector_table = find_dissector_table("ethertype");
}
}
+/* Main Dissector */
+/* Notes: */
+/* 1.) Floating "offset+=" statements should probably be "functionized" but they are inline */
+/* Offset is only passed by reference in specific places, so do not be confused when following code */
+/* In any code path, adding up "offset+=" statements will tell you what byte you are at */
static void
dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree)
{
proto_tree *base_transport_header_tree = NULL;
proto_item *base_transport_header_item = NULL;
- /* Raw Data - no decoding. */
- proto_item *raw_ipv6 = NULL;
- proto_item *raw_RWH_Ethertype;
+ /* Raw Data */
+ proto_tree *RAWDATA_header_tree;
+ proto_item *RAWDATA_header_item;
+ guint8 lnh_val = 0; /* Link Next Header Value */
+ gint offset = 0; /* Current Offset */
+ /* General Variables */
gboolean bthFollows = 0; /* Tracks if we are parsing a BTH. This is a significant decision point */
- guint8 lnh_val = 0; /* Link Next Header Value */
- gint offset = 0; /* Current Offset */
+ guint8 virtualLane = 0; /* IB VirtualLane. Keyed off of for detecting subnet admin/management */
guint8 opCode = 0; /* OpCode from BTH header. */
gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
guint16 payloadLength = 0; /* Payload Length should it exist */
- guint8 nxtHdr = 0; /* */
- guint16 packetLength = 0; /* Packet Length. We track this as tvb->length - offset. It provides the parsing methods a known size */
- /* that must be available for that header. */
- e_guid_t SRCguid;
- e_guid_t DSTguid;
+ guint8 nxtHdr = 0; /* Keyed off for header dissection order */
+ guint16 packetLength = 0; /* Packet Length. We track this as tvb->length - offset. It provides the parsing methods a known size */ /* that must be available for that header. */
+ struct e_in6_addr SRCgid; /* Structures to hold GIDs should be need them */
+ struct e_in6_addr DSTgid;
+ gint crc_length = 0;
/* Mark the Packet type as Infiniband in the wireshark UI */
/* Clear other columns */
col_set_str(pinfo->cinfo, COL_PROTOCOL, "InfiniBand");
if(check_col(pinfo->cinfo, COL_INFO))
col_clear(pinfo->cinfo, COL_INFO);
+
+ g_cinfo = pinfo->cinfo;
}
- /* Get the parent tree from the ERF dissector */
+ /* Global ref to Pinfo for dissection routines where necessary */
+ g_pinfo = pinfo;
+
+ /* Get the parent tree from the ERF dissector. We don't want to nest under ERF */
if(tree && tree->parent)
{
+ /* Set the normal tree outside of ERF */
tree = tree->parent;
+ /* Set a global reference for nested protocols */
+ top_tree = tree;
+ }
+
+ if(!tree)
+ {
+ /* If no packet details are being dissected, extract some high level info for the packet view */
+ /* Assigns column values rather than full tree population */
+ dissect_general_info(tvb, offset, pinfo);
+ return;
}
- if(tree)
- {
- /* proto_tree* proto_item_add_subtree(proto_item *ti, gint idx); */
+ /* Top Level Packet */
+ infiniband_packet = proto_tree_add_item(tree, proto_infiniband, tvb, offset, -1, FALSE);
- /* Top Level Packet */
- infiniband_packet = proto_tree_add_item(tree, proto_infiniband, tvb, offset, -1, FALSE);
+ /* Headers Level Tree */
+ all_headers_tree = proto_item_add_subtree(infiniband_packet, ett_all_headers);
- /* Headers Level Tree */
- all_headers_tree = proto_item_add_subtree(infiniband_packet, ett_infiniband);
+ /* Local Route Header Subtree */
+ local_route_header_item = proto_tree_add_bytes(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, tvb->real_data);
+ proto_item_set_text(local_route_header_item, "%s", "Local Route Header");
+ local_route_header_tree = proto_item_add_subtree(local_route_header_item, ett_lrh);
- /* Local Route Header Subtree */
- local_route_header_item = proto_tree_add_bytes(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, tvb->real_data);
- proto_item_set_text(local_route_header_item, "%s", "Local Route Header");
- local_route_header_tree = proto_item_add_subtree(local_route_header_item, ett_infiniband);
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane, tvb, offset, 1, FALSE);
+
+
+ /* Get the Virtual Lane. We'll use this to identify Subnet Management and Subnet Administration Packets. */
+ virtualLane = tvb_get_guint8(tvb, offset);
+ virtualLane = virtualLane & 0xF0;
+
+
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version, tvb, offset, 1, FALSE); offset+=1;
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level, tvb, offset, 1, FALSE);
+
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved2, tvb, offset, 1, FALSE);
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header, tvb, offset, 1, FALSE);
- proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane, tvb, offset, 1, FALSE);
- proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version, tvb, offset, 1, FALSE); offset+=1;
- proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level, tvb, offset, 1, FALSE);
- proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved2, tvb, offset, 1, FALSE);
- proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header, tvb, offset, 1, FALSE);
- }
- else
- {
- offset+=1;
- }
-
/* Save Link Next Header... This tells us what the next header is. */
lnh_val = tvb_get_guint8(tvb, offset);
lnh_val = lnh_val & 0x03;
offset+=1;
- if(tree)
- {
- proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id, tvb, offset, 2, FALSE);
- }
+
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id, tvb, offset, 2, FALSE);
+
/* Set destination in packet view. */
if (check_col(pinfo->cinfo, COL_DEF_DST))
}
offset+=2;
- if(tree)
- {
- proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5, tvb, offset, 2, FALSE);
- }
+
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5, tvb, offset, 2, FALSE);
packetLength = tvb_get_ntohs(tvb, offset); /* Get the Packet Length. This will determine payload size later on. */
packetLength = packetLength & 0x07FF; /* Mask off top 5 bits, they are reserved */
- packetLength = packetLength * 4; /* Multiply by 4 to get true byte length. This is by specification. PktLen is size in 4 byte words (byteSize /4). */
-
- if(tree)
- {
- proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length, tvb, offset, 2, FALSE); offset+=2;
- proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id, tvb, offset, 2, FALSE);
- }
- else
- {
- offset+=2;
- }
+ packetLength = packetLength * 4; /* Multiply by 4 to get true byte length. This is by specification. PktLen is size in 4 byte words (byteSize /4). */
+
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length, tvb, offset, 2, FALSE); offset+=2;
+ proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id, tvb, offset, 2, FALSE);
/* Set Source in packet view. */
if (check_col(pinfo->cinfo, COL_DEF_SRC))
col_set_fence(pinfo->cinfo, COL_DEF_SRC);
col_set_str(pinfo->cinfo, COL_DEF_SRC, tvb_bytes_to_str(tvb, offset, 2));
}
+
offset+=2;
packetLength -= 8; /* Shave 8 bytes for the LRH. */
+ /* Key off Link Next Header. This tells us what High Level Data Format we have */
switch(lnh_val)
{
case IBA_GLOBAL:
- payloadLength = tvb_get_ntohs(tvb, offset + 4);
- nxtHdr = tvb_get_guint8(tvb, offset + 6);
- if(tree)
- {
- global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, FALSE);
- proto_item_set_text(global_route_header_item, "%s", "Global Route Header");
- global_route_header_tree = proto_item_add_subtree(global_route_header_item, ett_infiniband);
- proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version, tvb, offset, 1, FALSE);
- proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class, tvb, offset, 2, FALSE);
- proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label, tvb, offset, 4, FALSE); offset += 4;
- proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length, tvb, offset, 2, FALSE); offset += 2;
- proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid, tvb, offset, 16, FALSE);
- }
- else
- {
- offset+=8;
- }
+ global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, FALSE);
+ proto_item_set_text(global_route_header_item, "%s", "Global Route Header");
+ global_route_header_tree = proto_item_add_subtree(global_route_header_item, ett_grh);
+
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version, tvb, offset, 1, FALSE);
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class, tvb, offset, 2, FALSE);
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label, tvb, offset, 4, FALSE); offset += 4;
+
+ payloadLength = tvb_get_ntohs(tvb, offset);
+
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length, tvb, offset, 2, FALSE); offset += 2;
+
+ nxtHdr = tvb_get_guint8(tvb, offset);
- tvb_get_ntohguid(tvb, offset,&SRCguid);
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header, tvb, offset, 1, FALSE); offset +=1;
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit, tvb, offset, 1, FALSE); offset +=1;
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid, tvb, offset, 16, FALSE);
+
+ tvb_get_ipv6(tvb, offset, &SRCgid);
if (check_col(pinfo->cinfo, COL_DEF_SRC))
{
col_set_str(pinfo->cinfo, COL_DEF_SRC, "SGID: ");
col_set_fence(pinfo->cinfo, COL_DEF_SRC);
- col_set_str(pinfo->cinfo, COL_DEF_SRC, guid_to_str(&SRCguid));
+ col_set_str(pinfo->cinfo, COL_DEF_SRC, ip6_to_str(&SRCgid));
}
offset += 16;
- if(tree)
- {
- proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid, tvb, offset, 16, FALSE); offset +=16;
- }
- else
- {
- offset+=16;
- }
+ proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid, tvb, offset, 16, FALSE);
- tvb_get_ntohguid(tvb, offset, &DSTguid);
+ tvb_get_ipv6(tvb, offset, &DSTgid);
if (check_col(pinfo->cinfo, COL_DEF_DST))
{
col_set_str(pinfo->cinfo, COL_DEF_DST, "DGID: ");
col_set_fence(pinfo->cinfo, COL_DEF_DST);
- col_set_str(pinfo->cinfo, COL_DEF_DST, guid_to_str(&DSTguid));
+ col_set_str(pinfo->cinfo, COL_DEF_DST, ip6_to_str(&DSTgid));
}
offset += 16;
-
-
-
packetLength -= 40; /* Shave 40 bytes for GRH */
+
if(nxtHdr != 0x1B)
{
- if(tree)
- {
- /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
- proto_tree *RAWDATA_header_tree = NULL;
- proto_item *RAWDATA_header_item = NULL;
- RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
- proto_item_set_text(RAWDATA_header_item, "%s", "Raw Data - Non IBA local transport");
- RAWDATA_header_tree = proto_item_add_subtree(RAWDATA_header_item, ett_infiniband);
- }
- break;
+ /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
+ break;
}
-
/* otherwise fall through and start parsing BTH */
-
case IBA_LOCAL:
bthFollows = TRUE;
+ base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, 12, FALSE);
+ proto_item_set_text(base_transport_header_item, "%s", "Base Transport Header");
+ base_transport_header_tree = proto_item_add_subtree(base_transport_header_item, ett_bth);
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode, tvb, offset, 1, FALSE);
- if(tree)
- {
- base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, 12, FALSE);
- proto_item_set_text(base_transport_header_item, "%s", "Base Transport Header");
- base_transport_header_tree = proto_item_add_subtree(base_transport_header_item, ett_infiniband);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode, tvb, offset, 1, FALSE);
- }
/* Get the OpCode - this tells us what headers are following */
opCode = tvb_get_guint8(tvb, offset);
if (check_col(pinfo->cinfo, COL_INFO))
{
- col_set_str(pinfo->cinfo, COL_INFO, " ");
- col_set_fence(pinfo->cinfo, COL_INFO);
- col_set_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
+ col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
}
offset +=1;
- if(tree)
- {
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key, tvb, offset, 2, FALSE); offset +=2;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved8, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_destination_qp, tvb, offset, 3, FALSE); offset +=3;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_packet_sequence_number, tvb, offset, 3, FALSE); offset +=3;
- }
- else
- {
- offset+=11;
- }
+
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event, tvb, offset, 1, FALSE);
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq, tvb, offset, 1, FALSE);
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count, tvb, offset, 1, FALSE);
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version, tvb, offset, 1, FALSE); offset +=1;
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key, tvb, offset, 2, FALSE); offset +=2;
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved8, tvb, offset, 1, FALSE); offset +=1;
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_destination_qp, tvb, offset, 3, FALSE); offset +=3;
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request, tvb, offset, 1, FALSE);
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7, tvb, offset, 1, FALSE); offset +=1;
+ proto_tree_add_item(base_transport_header_tree, hf_infiniband_packet_sequence_number, tvb, offset, 3, FALSE); offset +=3;
+
packetLength -= 12; /* Shave 12 for Base Transport Header */
break;
case IP_NON_IBA:
- if(!tree)
+ /* Raw IPv6 Packet */
+ if (check_col(pinfo->cinfo, COL_DEF_DST))
{
- break;
+ col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet");
+ col_set_fence(pinfo->cinfo, COL_DEF_DST);
}
-
- /* Raw IPv6 Packet */
- raw_ipv6 = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
- proto_item_set_text(raw_ipv6, "%s", "Raw (non-IBA Transport) IPv6 Packet");
+ parse_IPvSix(all_headers_tree, tvb, &offset, pinfo);
break;
case RAW:
- if(!tree)
- {
- break;
- }
-
- /* Raw (any other) Packet */
- raw_RWH_Ethertype = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
- proto_item_set_text(raw_RWH_Ethertype, "%s", "Raw (non-IBA Transport) Packet");
-
+ parse_RWH(all_headers_tree, tvb, &offset, pinfo);
break;
default:
- if(!tree)
- {
- break;
- }
-
/* Unknown Packet */
- raw_ipv6 = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
- proto_item_set_text(raw_ipv6, "%s", "Unknown (non-IBA Transport) Raw Data Packet");
+ RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
+ proto_item_set_text(RAWDATA_header_item, "%s", "Unknown Raw Data - IB Encapsulated");
+ RAWDATA_header_tree = proto_item_add_subtree(RAWDATA_header_item, ett_rawdata);
break;
}
- if(bthFollows && tree)
+ /* Base Transport header is hit quite often, however it is alone since it is the exception not the rule */
+ /* Only IBA Local packets use it */
+ if(bthFollows)
{
- /* Find our next header sequence based on the Opcode */
- /* Each case decrements the packetLength by the amount of bytes consumed by each header. */
- /* The find_next_header_sequence method could be used to automate this. */
- /* We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */
+ /* Find our next header sequence based on the Opcode
+ * Each case decrements the packetLength by the amount of bytes consumed by each header.
+ * The find_next_header_sequence method could be used to automate this.
+ * We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */
+
nextHeaderSequence = find_next_header_sequence((guint32) opCode);
+
+ /* find_next_header_sequence gives us the DEFINE value corresponding to the header order following */
+ /* Enumerations are named intuitively, e.g. RDETH DETH PAYLOAD means there is an RDETH Header, DETH Header, and a packet payload */
switch(nextHeaderSequence)
{
case RDETH_DETH_PAYLD:
packetLength -= 4; /* RDETH */
packetLength -= 8; /* DETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RDETH_DETH_RETH_PAYLD:
parse_RDETH(all_headers_tree, tvb, &offset);
packetLength -= 8; /* DETH */
packetLength -= 16; /* RETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RDETH_DETH_IMMDT_PAYLD:
parse_RDETH(all_headers_tree, tvb, &offset);
packetLength -= 8; /* DETH */
packetLength -= 4; /* IMMDT */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RDETH_DETH_RETH_IMMDT_PAYLD:
parse_RDETH(all_headers_tree, tvb, &offset);
packetLength -= 16; /* RETH */
packetLength -= 4; /* IMMDT */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RDETH_DETH_RETH:
parse_RDETH(all_headers_tree, tvb, &offset);
packetLength -= 4; /* RDETH */
packetLength -= 4; /* AETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RDETH_PAYLD:
parse_RDETH(all_headers_tree, tvb, &offset);
packetLength -= 4; /* RDETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RDETH_AETH:
parse_AETH(all_headers_tree, tvb, &offset);
packetLength -= 8; /* DETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case PAYLD:
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case IMMDT_PAYLD:
parse_IMMDT(all_headers_tree, tvb, &offset);
packetLength -= 4; /* IMMDT */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RETH_PAYLD:
parse_RETH(all_headers_tree, tvb, &offset);
packetLength -= 16; /* RETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case RETH:
parse_RETH(all_headers_tree, tvb, &offset);
packetLength -= 4; /* AETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case AETH:
parse_AETH(all_headers_tree, tvb, &offset);
packetLength -= 4; /* IETH */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
case DETH_IMMDT_PAYLD:
parse_DETH(all_headers_tree, tvb, &offset);
packetLength -= 8; /* DETH */
packetLength -= 4; /* IMMDT */
- parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength);
+ parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane);
break;
default:
parse_VENDOR(all_headers_tree, tvb, &offset);
break;
+
}
+
+ }
+ /* Display the ICRC/VCRC */
+ /* Doing it this way rather than in a variety of places according to the specific packet */
+ /* If we've already displayed it crc_length comes out 0 */
+ crc_length = tvb_reported_length_remaining(tvb, offset);
+ if(crc_length == 6)
+ {
+ proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4;
+ proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, FALSE); offset+=2;
+ }
+ else if(crc_length == 4)
+ {
+ proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4;
+ }
+ else if(crc_length == 2)
+ {
+ proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, FALSE); offset+=2;
}
+
}
-
-/* Description: Finds the header sequence that follows the Base Transport Header. */
-/* Somwhat inefficient (should be using a single key,value pair data structure) */
-/* But uses pure probablity to take a stab at better efficiency. */
-/* Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences */
-/* IN: OpCode: The OpCode from the Base Transport Header. */
-/* OUT: The Header Sequence enumeration. See Declarations for #defines from (0-22) */
+/* Description: Finds the header sequence that follows the Base Transport Header.
+* Somwhat inefficient (should be using a single key,value pair data structure)
+* But uses pure probablity to take a stab at better efficiency.
+* Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences
+* IN: OpCode: The OpCode from the Base Transport Header.
+* OUT: The Header Sequence enumeration. See Declarations for #defines from (0-22) */
static gint32
find_next_header_sequence(guint32 OpCode)
{
return -1;
}
-/* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere, */
-/* But I'd rather define my own. */
-/* IN: OpCode: The OpCode you are looking for */
-/* IN: Codes: The organized array of OpCodes to look through */
-/* IN: Array length, because we're in C... */
-/* OUT: Boolean indicating if that OpCode was found in OpCodes */
+/* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere,
+* But I'd rather define my own.
+* IN: OpCode: The OpCode you are looking for
+* IN: Codes: The organized array of OpCodes to look through
+* IN: Array length, because we're in C++...
+* OUT: Boolean indicating if that OpCode was found in OpCodes */
static gboolean
contains(guint32 OpCode, guint32* Codes, gint32 length)
{
return FALSE;
}
-/* Parse RDETH - Reliable Datagram Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse RDETH - Reliable Datagram Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
RDETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RDETH, tvb, local_offset, 4, FALSE);
proto_item_set_text(RDETH_header_item, "%s", "RDETH - Reliable Datagram Extended Transport Header");
- RDETH_header_tree = proto_item_add_subtree(RDETH_header_item, ett_infiniband);
-
- proto_tree_add_item(RDETH_header_tree, hf_infiniband_reserved8_RDETH, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context, tvb, local_offset, 3, FALSE); local_offset+=3;
+ RDETH_header_tree = proto_item_add_subtree(RDETH_header_item, ett_rdeth);
+ proto_tree_add_item(RDETH_header_tree, hf_infiniband_reserved8_RDETH, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context, tvb, local_offset, 3, FALSE); local_offset+=3;
*offset = local_offset;
}
-/* Parse DETH - Datagram Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse DETH - Datagram Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
DETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_DETH, tvb, local_offset, 8, FALSE);
proto_item_set_text(DETH_header_item, "%s", "DETH - Datagram Extended Transport Header");
- DETH_header_tree = proto_item_add_subtree(DETH_header_item, ett_infiniband);
+ DETH_header_tree = proto_item_add_subtree(DETH_header_item, ett_deth);
proto_tree_add_item(DETH_header_tree, hf_infiniband_queue_key, tvb, local_offset, 4, FALSE); local_offset+=4;
proto_tree_add_item(DETH_header_tree, hf_infiniband_reserved8_DETH, tvb, local_offset, 1, FALSE); local_offset+=1;
*offset = local_offset;
}
-/* Parse RETH - RDMA Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse RETH - RDMA Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
RETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RETH, tvb, local_offset, 16, FALSE);
proto_item_set_text(RETH_header_item, "%s", "RETH - RDMA Extended Transport Header");
- RETH_header_tree = proto_item_add_subtree(RETH_header_item, ett_infiniband);
+ RETH_header_tree = proto_item_add_subtree(RETH_header_item, ett_reth);
proto_tree_add_item(RETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, FALSE); local_offset+=8;
proto_tree_add_item(RETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, FALSE); local_offset+=4;
*offset = local_offset;
}
-/* Parse AtomicETH - Atomic Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse AtomicETH - Atomic Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
ATOMICETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicETH, tvb, local_offset, 28, FALSE);
proto_item_set_text(ATOMICETH_header_item, "%s", "AtomicETH - Atomic Extended Transport Header");
- ATOMICETH_header_tree = proto_item_add_subtree(ATOMICETH_header_item, ett_infiniband);
+ ATOMICETH_header_tree = proto_item_add_subtree(ATOMICETH_header_item, ett_atomiceth);
proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, FALSE); local_offset+=8;
proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, FALSE); local_offset+=4;
proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_swap_or_add_data, tvb, local_offset, 8, FALSE); local_offset+=8;
proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_compare_data, tvb, local_offset, 8, FALSE); local_offset+=8;
-
*offset = local_offset;
}
-/* Parse AETH - ACK Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse AETH - ACK Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
AETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AETH, tvb, local_offset, 4, FALSE);
proto_item_set_text(AETH_header_item, "%s", "AETH - ACK Extended Transport Header");
- AETH_header_tree = proto_item_add_subtree(AETH_header_item, ett_infiniband);
+ AETH_header_tree = proto_item_add_subtree(AETH_header_item, ett_aeth);
proto_tree_add_item(AETH_header_tree, hf_infiniband_syndrome, tvb, local_offset, 1, FALSE); local_offset+=1;
proto_tree_add_item(AETH_header_tree, hf_infiniband_message_sequence_number, tvb, local_offset, 3, FALSE); local_offset+=3;
*offset = local_offset;
}
-/* Parse AtomicAckEth - Atomic ACK Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse AtomicAckEth - Atomic ACK Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
ATOMICACKETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicAckETH, tvb, local_offset, 8, FALSE);
proto_item_set_text(ATOMICACKETH_header_item, "%s", "ATOMICACKETH - Atomic ACK Extended Transport Header");
- ATOMICACKETH_header_tree = proto_item_add_subtree(ATOMICACKETH_header_item, ett_infiniband);
-
+ ATOMICACKETH_header_tree = proto_item_add_subtree(ATOMICACKETH_header_item, ett_atomicacketh);
proto_tree_add_item(ATOMICACKETH_header_tree, hf_infiniband_original_remote_data, tvb, local_offset, 8, FALSE); local_offset+=8;
-
*offset = local_offset;
}
-/* Parse IMMDT - Immediate Data Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse IMMDT - Immediate Data Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
IMMDT_header_item = proto_tree_add_item(parentTree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE);
proto_item_set_text(IMMDT_header_item, "%s", "IMMDT - Immediate Data Extended Transport Header");
- IMMDT_header_tree = proto_item_add_subtree(IMMDT_header_item, ett_infiniband);
-
+ IMMDT_header_tree = proto_item_add_subtree(IMMDT_header_item, ett_immdt);
proto_tree_add_item(IMMDT_header_tree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE); local_offset+=4;
-
*offset = local_offset;
}
-/* Parse IETH - Invalidate Extended Transport Header */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
+/* Parse IETH - Invalidate Extended Transport Header
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
static void
parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
IETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE);
proto_item_set_text(IETH_header_item, "%s", "IETH - Invalidate Extended Transport Header");
- IETH_header_tree = proto_item_add_subtree(IETH_header_item, ett_infiniband);
+ IETH_header_tree = proto_item_add_subtree(IETH_header_item, ett_ieth);
proto_tree_add_item(IETH_header_tree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE); local_offset+=4;
*offset = local_offset;
}
-/* Parse Payload - Packet Payload / Invariant CRC / Variant CRC */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
-/* IN: Length of Payload */
-static void
-parse_PAYLOAD(proto_tree * parentTree, tvbuff_t *tvb, gint *offset, gint length)
+/* Parse Payload - Packet Payload / Invariant CRC / Variant CRC
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset
+* IN: Length of Payload */
+static void parse_PAYLOAD(proto_tree * parentTree, tvbuff_t *tvb, gint *offset, gint length, guint8 virtualLane)
{
gint local_offset = *offset;
/* Payload - Packet Payload */
proto_tree *PAYLOAD_header_tree = NULL;
proto_item *PAYLOAD_header_item = NULL;
-
- if((length + local_offset) >= (gint)(tvb->length)) /* oreviously consumed bytes + offset was all the data - none or corrupt payload*/
+ guint8 management_class;
+ tvbuff_t *next_tvb;
+ gint captured_length, reported_length;
+ guint16 etype, reserved;
+ const char *saved_proto;
+ volatile gboolean dissector_found = FALSE;
+
+ if(!tvb_bytes_exist(tvb, *offset, length)) /* previously consumed bytes + offset was all the data - none or corrupt payload */
{
- /* Error condition */
+ if (check_col(g_cinfo, COL_INFO))
+ {
+ col_set_str(g_cinfo, COL_INFO, "Invalid Packet Length from LRH! [Malformed Packet]");
+ col_set_fence(g_cinfo, COL_INFO);
+ }
return;
}
+ if(virtualLane == 0xF0)
+ {
+ management_class = tvb_get_guint8(tvb, (*offset) + 1);
+
+ if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END))
+ || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END)))
+ {
+ /* parse vendor specific */
+ parse_VENDOR_MANAGEMENT(parentTree, tvb, offset);
+ }
+ else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END))
+ {
+ /* parse application specific */
+ parse_APPLICATION_MANAGEMENT(parentTree, tvb, offset);
+ }
+ else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02))
+ || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80))
+ || ((management_class >= (guint8)0x82)))
+ {
+ /* parse reserved classes */
+ parse_RESERVED_MANAGEMENT(parentTree, tvb, offset);
+ }
+ else /* we have a normal management_class */
+ {
+ switch(management_class)
+ {
+ case SUBN_LID_ROUTED:
+ /* parse subn man lid routed */
+ parse_SUBN_LID_ROUTED(parentTree, tvb, &local_offset);
+ break;
+ case SUBN_DIRECTED_ROUTE:
+ /* parse subn directed route */
+ parse_SUBN_DIRECTED_ROUTE(parentTree, tvb, &local_offset);
+ break;
+ case SUBNADMN:
+ /* parse sub admin */
+ parse_SUBNADMN(parentTree, tvb, &local_offset);
+ break;
+ case PERF:
+ /* parse performance */
+ parse_PERF(parentTree, tvb, &local_offset);
+ break;
+ case BM:
+ /* parse baseboard mgmt */
+ parse_BM(parentTree, tvb, &local_offset);
+ break;
+ case DEV_MGT:
+ /* parse device management */
+ parse_DEV_MGT(parentTree, tvb, &local_offset);
+ break;
+ case COM_MGT:
+ /* parse communication management */
+ parse_COM_MGT(parentTree, tvb, &local_offset);
+ break;
+ case SNMP:
+ /* parse snmp tunneling */
+ parse_SNMP(parentTree, tvb, &local_offset);
+ break;
+ default:
+ break;
+ }
+ }
+ }
+ else /* Normal Data Packet - Parse as such */
+ {
+
+ /* Calculation for Payload:
+ * (tvb->length) Length of entire packet - (local_offset) Starting byte of Payload Data
+ * offset addition is more complex for the payload.
+ * We need the total length of the packet, - length of previous headers, + offset where payload started.
+ * We also need to reserve 6 bytes for the CRCs which are not actually part of the payload. */
+
+ /* IBA packet data could be anything in principle, however it is common
+ * practice to carry non-IBA data encapsulated with an EtherType header,
+ * similar to the RWH header. There is no way to identify these frames
+ * positively.
+ *
+ * We see if the first few bytes look like an EtherType header, and if so
+ * call the appropriate dissector. If not we call the "data" dissector.
+ */
+
+ etype = tvb_get_ntohs(tvb, local_offset);
+ reserved = tvb_get_ntohs(tvb, local_offset + 2);
+
+ if (reserved == 0) {
+
+ /* Get the captured length and reported length of the data
+ after the Ethernet type. */
+ captured_length = tvb_length_remaining(tvb, local_offset+4);
+ reported_length = tvb_reported_length_remaining(tvb,
+ local_offset+4);
+
+ next_tvb = tvb_new_subset(tvb, local_offset+4, captured_length,
+ reported_length);
+
+ g_pinfo->ethertype = etype;
+
+ /* Look for sub-dissector, and call it if found.
+ Catch exceptions, so that if the reported length of "next_tvb"
+ was reduced by some dissector before an exception was thrown,
+ we can still put in an item for the trailer. */
+ saved_proto = g_pinfo->current_proto;
+ TRY {
+ dissector_found = dissector_try_port(ethertype_dissector_table,
+ etype, next_tvb, g_pinfo, top_tree);
+ }
+ CATCH(BoundsError) {
+ /* Somebody threw BoundsError, which means that:
+
+ 1) a dissector was found, so we don't need to
+ dissect the payload as data or update the
+ protocol or info columns;
+
+ 2) dissecting the payload found that the packet was
+ cut off by a snapshot length before the end of
+ the payload. The trailer comes after the payload,
+ so *all* of the trailer is cut off, and we'll
+ just get another BoundsError if we add the trailer.
+
+ Therefore, we just rethrow the exception so it gets
+ reported; we don't dissect the trailer or do anything
+ else. */
+ RETHROW;
+ }
+ CATCH(OutOfMemoryError) {
+ RETHROW;
+ }
+ CATCH_ALL {
+ /* Somebody threw an exception other than BoundsError, which
+ means that a dissector was found, so we don't need to
+ dissect the payload as data or update the protocol or info
+ columns. We just show the exception and then drive on
+ to show the trailer, after noting that a dissector was
+ found and restoring the protocol value that was in effect
+ before we called the subdissector. */
+ show_exception(next_tvb, g_pinfo, top_tree, EXCEPT_CODE, GET_MESSAGE);
+ dissector_found = TRUE;
+ g_pinfo->current_proto = saved_proto;
+ }
+ ENDTRY;
+
+ if (dissector_found) {
+ /* now create payload entry to show Ethertype */
+ PAYLOAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_payload, tvb, local_offset, tvb_reported_length_remaining(tvb, local_offset)-6, FALSE);
+ proto_item_set_text(PAYLOAD_header_item, "%s", "IBA Payload - appears to be EtherType encapsulated");
+ PAYLOAD_header_tree = proto_item_add_subtree(PAYLOAD_header_item, ett_payload);
+ proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_etype, tvb,
+ local_offset, 2, tvb_get_ntohs(tvb, local_offset));
+ local_offset += 2;
- /* Calculation for Payload: */
- /* (tvb->length) Length of entire packet - (local_offset) Starting byte of Payload Data */
- PAYLOAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_payload, tvb, local_offset, (tvb->length) - local_offset, FALSE); local_offset += (tvb->length - 6 - local_offset);
- proto_item_set_text(PAYLOAD_header_item, "%s", "Payload");
- PAYLOAD_header_tree = proto_item_add_subtree(PAYLOAD_header_item, ett_infiniband);
+ proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_reserved16_RWH, tvb,
+ local_offset, 2, tvb_get_ntohs(tvb, local_offset));
+
+
+ } else {
+ tvb_free(next_tvb);
+ }
+
+ }
+
+ if (!dissector_found) {
+ /* No sub-dissector found.
+ Label rest of packet as "Data" */
+
+ captured_length = tvb_length_remaining(tvb, local_offset);
+ reported_length = tvb_reported_length_remaining(tvb,
+ local_offset);
+
+ if (reported_length >= 6)
+ reported_length -= 6;
+ if (captured_length > reported_length)
+ captured_length = reported_length;
+
+ next_tvb = tvb_new_subset(tvb, local_offset,
+ captured_length,
+ reported_length);
+
+ call_dissector(data_handle, next_tvb, g_pinfo, top_tree);
+
+ }
+
- /* offset addition is more complex for the payload. */
- /* We need the total length of the packet, - length of previous headers, + offset where payload started. */
- /* We also need to reserve 6 bytes for the CRCs which are not actually part of the payload. */
- proto_tree_add_item(PAYLOAD_header_tree, hf_infiniband_invariant_crc, tvb, local_offset, 4, FALSE); local_offset +=4;
- proto_tree_add_item(PAYLOAD_header_tree, hf_infiniband_variant_crc, tvb, local_offset, 2, FALSE); local_offset +=2;
+ /*parse_RWH(parentTree, tvb, &local_offset, g_pinfo);*/
+
+ /* Will contain ICRC and VCRC = 4+2 */
+ local_offset = tvb_reported_length(tvb) - 6;
+ }
*offset = local_offset;
}
-/* Parse VENDOR - Parse a vendor specific or unknown header sequence */
-/* IN: parentTree to add the dissection too - in this code the all_headers_tree */
-/* IN: tvb - the data buffer from wireshark */
-/* IN/OUT: The current and updated offset */
-static void
-parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
+/* Parse VENDOR - Parse a vendor specific or unknown header sequence
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
gint local_offset = *offset;
- /* IETH - Invalidate Extended Transport Header */
proto_tree *VENDOR_header_tree = NULL;
proto_item *VENDOR_header_item = NULL;
VENDOR_header_item = proto_tree_add_item(parentTree, hf_infiniband_vendor, tvb, local_offset, 4, FALSE);
proto_item_set_text(VENDOR_header_item, "%s", "Vendor Specific or Unknown Header Sequence");
- VENDOR_header_tree = proto_item_add_subtree(VENDOR_header_item, ett_infiniband);
-
+ VENDOR_header_tree = proto_item_add_subtree(VENDOR_header_item, ett_vendor);
proto_tree_add_item(VENDOR_header_tree, hf_infiniband_vendor, tvb, local_offset, -1, FALSE);
+ *offset = local_offset;
+}
+
+/* Parse IPv6 - Parse an IPv6 Packet
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_IPvSix(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, packet_info *pinfo)
+{
+ tvbuff_t *ipv6_tvb;
+
+ if(ipv6_handle == NULL)
+ {
+ ipv6_handle = find_dissector("ipv6");
+ }
+
+ /* (- 2) for VCRC which lives at the end of the packet */
+ ipv6_tvb = tvb_new_subset(tvb, *offset,
+ tvb_length_remaining(tvb, *offset) - 2,
+ tvb_reported_length_remaining(tvb, *offset) - 2);
+ call_dissector(ipv6_handle, ipv6_tvb, pinfo, parentTree);
+ *offset = tvb_reported_length(tvb) - 2;
+
+ /* Display the VCRC */
+ proto_tree_add_item(parentTree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE);
+}
+
+/* Parse EtherType - Parse a generic IP packaet with an EtherType of IP or ARP
+* IN: parentTree to add the dissection to - in this code the all_headers_tree
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_RWH(proto_tree * ah_tree, tvbuff_t *tvb, gint *offset, packet_info *pinfo)
+{
+ guint16 ether_type;
+
+ /* RWH - Raw Header */
+ proto_tree *RWH_header_tree = NULL;
+ proto_item *RWH_header_item = NULL;
+
+ RWH_header_item = proto_tree_add_item(ah_tree, hf_infiniband_RWH, tvb, *offset, 4, FALSE);
+ proto_item_set_text(RWH_header_item, "%s", "RWH - Raw Header");
+ RWH_header_tree = proto_item_add_subtree(RWH_header_item, ett_rwh);
+
+ ether_type = tvb_get_ntohs(tvb, *offset);
+ //ether_type = ether_type & 0x0F; /* mask off reserved bits just in case. */
+ *offset += 2;
+
+ proto_tree_add_uint(RWH_header_tree, hf_infiniband_reserved16_RWH, tvb,
+ *offset, 2, tvb_get_ntohs(tvb, *offset));
+
+ *offset += 2;
+
+ ethertype(ether_type, tvb, *offset, pinfo, top_tree, RWH_header_tree, hf_infiniband_etype, -1, 0);
+
+ *offset = tvb_reported_length(tvb) - 2;
+ /* Display the VCRC */
+ proto_tree_add_item(ah_tree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE);
+
+}
+
+/* Parse Subnet Management (LID Routed)
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_SUBN_LID_ROUTED(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_tree *SUBN_LID_ROUTED_header_tree = NULL;
+ proto_item *SUBN_LID_ROUTED_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+
+ local_offset = *offset;
+
+ /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section. */
+ SUBN_LID_ROUTED_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_LID, tvb, local_offset - 24, 256, FALSE);
+ proto_item_set_text(SUBN_LID_ROUTED_header_item, "%s", "SMP (LID Routed) ");
+ SUBN_LID_ROUTED_header_tree = proto_item_add_subtree(SUBN_LID_ROUTED_header_item, ett_subn_lid_routed);
+ proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved256, tvb, local_offset, 32, FALSE); local_offset +=32;
+
+ label_SUBM_Method(SUBN_LID_ROUTED_header_item, &MadData);
+ label_SUBM_Attribute(SUBN_LID_ROUTED_header_item, &MadData);
+
+ /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
+ if(!parse_SUBM_Attribute(SUBN_LID_ROUTED_header_tree, tvb, &local_offset, &MadData))
+ {
+ proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); local_offset +=64;
+ }
+
+ proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved1024, tvb, local_offset, 128, FALSE); local_offset +=128;
+ *offset = local_offset;
+}
+
+/* Parse Subnet Management (Directed Route)
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_SUBN_DIRECTED_ROUTE(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_tree *SUBN_DIRECTED_ROUTE_header_tree = NULL;
+ proto_item *SUBN_DIRECTED_ROUTE_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+
+ local_offset = *offset;
+
+ /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section.
+ * We need to go backwards because this particular SMP uses the class specific portion of the Common MAD Header */
+ SUBN_DIRECTED_ROUTE_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_DIRECTED, tvb, local_offset - 24, 256, FALSE);
+ proto_item_set_text(SUBN_DIRECTED_ROUTE_header_item, "%s", "SMP (Directed Route) ");
+ SUBN_DIRECTED_ROUTE_header_tree = proto_item_add_subtree(SUBN_DIRECTED_ROUTE_header_item, ett_subn_directed_route);
+
+ label_SUBM_Method(SUBN_DIRECTED_ROUTE_header_item, &MadData);
+ label_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_item, &MadData);
+
+ /* Place us at offset 4, the "D" Bit (Direction bit for Directed Route SMPs) */
+ local_offset -= 20;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_d, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_status, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_pointer, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_count, tvb, local_offset, 1, FALSE); local_offset +=1;
+ local_offset += 16; /* Skip over the rest of the Common MAD Header... It's already dissected by parse_MAD_Common */
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_slid, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_dlid, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_reserved28, tvb, local_offset, 28, FALSE); local_offset +=28;
+
+ /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
+ if(!parse_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_tree, tvb, &local_offset, &MadData))
+ {
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); local_offset +=64;
+ }
+
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_initial_path, tvb, local_offset, 64, FALSE); local_offset +=64;
+ proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_return_path, tvb, local_offset, 64, FALSE); local_offset +=64;
+ *offset = local_offset;
+}
+
+/* Parse Subnet Administration
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_SUBNADMN(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_tree *SUBNADMN_header_tree = NULL;
+ proto_item *SUBNADMN_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ if(!parse_RMPP(parentTree, tvb, offset))
+ {
+ /* TODO: Mark Corrupt Packet */
+ return;
+ }
+ local_offset = *offset;
+
+ SUBNADMN_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset - 36, 256, FALSE);
+ proto_item_set_text(SUBNADMN_header_item, "%s", "SMA");
+ SUBNADMN_header_tree = proto_item_add_subtree(SUBNADMN_header_item, ett_subnadmin);
+
+ proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_sm_key, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_attribute_offset, tvb, local_offset, 2, FALSE); local_offset+=4;
+ proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_reserved16, tvb, local_offset, 2, FALSE); local_offset+=4;
+ proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_component_mask, tvb, local_offset, 8, FALSE); local_offset+=8;
+ label_SUBA_Method(SUBNADMN_header_item, &MadData);
+ label_SUBA_Attribute(SUBNADMN_header_item, &MadData);
+
+ if(!parse_SUBA_Attribute(SUBNADMN_header_tree, tvb, &local_offset, &MadData))
+ {
+ proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_subnet_admin_data, tvb, local_offset, 200, FALSE); local_offset+=200;
+ }
+ *offset = local_offset;
+}
+
+/* Parse Performance Management
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_PERF(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "PERF - Performance Management MAD (Dissector Not Implemented)");
+ *offset = local_offset;
+}
+
+/* Parse Baseboard Management
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_BM(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "BM - Baseboard Management MAD (Dissector Not Implemented)");
+ *offset = local_offset;
+}
+
+/* Parse Device Management
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_DEV_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "DEV_MGT - Device Management MAD (Dissector Not Implemented)");
+ *offset = local_offset;
+}
+
+/* Parse Communications Management
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_COM_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "COMM - Communication Management MAD (Dissector Not Implemented)");
+ *offset = local_offset;
+}
+
+/* Parse SNMP Tunneling
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_SNMP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "SNMP - SNMP Tunneling MAD (Dissector Not Implemented)");
+ *offset = local_offset;
+}
+
+/* Parse Vendor Specific Management Packets
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_VENDOR_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "VENDOR - Vendor Specific Management MAD (Dissector Not Implemented)");
+ *offset = local_offset;
+}
+
+/* Parse Application Specific Management Packets
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_APPLICATION_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "APP - Application Specific MAD (Dissector Not Implemented)");
*offset = local_offset;
}
+/* Parse Reserved Management Packets.
+* This is an !ERROR CONDITION!
+* It means that the Management Class value used was defined as a reserved value for furture use.
+* This method is here since we will want to report this information directly to the UI without blowing up Wireshark.
+
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static void parse_RESERVED_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ /* Parse the Common MAD Header */
+ MAD_Data MadData;
+ gint local_offset;
+ proto_item *PERF_header_item = NULL;
+
+ if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
+ {
+ /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
+ return;
+ }
+ local_offset = *offset;
+ PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
+ proto_item_set_text(PERF_header_item, "%s", "RESERVED - Reserved MAD Type (Possible Device Error)");
+ *offset = local_offset;
+}
+
+/* Parse the common MAD Header
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset
+* IN/OUT: MadData - the data from the MAD header */
+static gboolean parse_MAD_Common(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data* MadData)
+{
+ gint local_offset = *offset;
+ proto_tree *MAD_header_tree = NULL;
+ proto_item *MAD_header_item = NULL;
+
+ if(MadData == NULL)
+ return FALSE;
+ if(!tvb_bytes_exist(tvb, *offset, 256))
+ return FALSE;
+
+ /* Get the Management Class to decide between LID Routed and Direct Route */
+ MadData->managementClass = tvb_get_guint8(tvb, local_offset + 1);
+ MadData->classVersion = tvb_get_guint8(tvb, local_offset + 2);
+ MadData->method = tvb_get_guint8(tvb, local_offset + 3);
+ MadData->status = tvb_get_guint8(tvb, local_offset + 4);
+ MadData->classSpecific = tvb_get_ntohs(tvb, local_offset + 6);
+ MadData->transactionID = tvb_get_ntoh64(tvb, local_offset + 8);
+ MadData->attributeID = tvb_get_ntohs(tvb, local_offset + 16);
+ MadData->attributeModifier = tvb_get_ntohl(tvb, local_offset + 20);
+ tvb_memcpy(tvb, MadData->data, local_offset + 24, 232);
+
+ /* Populate the Dissector Tree */
+
+ MAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_MAD, tvb, local_offset, 256, FALSE);
+ proto_item_set_text(MAD_header_item, "%s", "MAD Header - Common Management Datagram");
+ MAD_header_tree = proto_item_add_subtree(MAD_header_item, ett_mad);
+
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_base_version, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_mgmt_class, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_class_version, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_method, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_status, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_class_specific, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_transaction_id, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_id, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_reserved16, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_modifier, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(MAD_header_tree, hf_infiniband_data, tvb, local_offset, 232, FALSE); local_offset+=232;
+ *offset = (local_offset - 232); /* Move the offset back to the start of the Data field - this will be where the other parsers start. */
+
+ return TRUE;
+}
+
+/* Parse the RMPP (Reliable Multi-Packet Transaction Protocol
+* IN: parentTree to add the dissection to
+* IN: tvb - the data buffer from wireshark
+* IN/OUT: The current and updated offset */
+static gboolean parse_RMPP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ guint8 RMPP_Type = tvb_get_guint8(tvb, local_offset + 1);
+ proto_tree *RMPP_header_tree = NULL;
+ proto_item *RMPP_header_item = NULL;
+
+ RMPP_header_item = proto_tree_add_item(parentTree, hf_infiniband_RMPP, tvb, local_offset, 12, FALSE);
+ proto_item_set_text(RMPP_header_item, "%s", val_to_str(RMPP_Type, RMPP_Packet_Types, "Reserved RMPP Type! (0x%02x)"));
+ RMPP_header_tree = proto_item_add_subtree(RMPP_header_item, ett_rmpp);
+
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_version, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_type, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_r_resp_time, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_flags, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_status, tvb, local_offset, 1, FALSE); local_offset+=1;
+ switch(RMPP_Type)
+ {
+ case RMPP_ILLEGAL:
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data1, tvb, local_offset, 32, FALSE); local_offset+=32;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data2, tvb, local_offset, 32, FALSE); local_offset+=32;
+ break;
+ case RMPP_DATA:
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_payload_length32, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_transferred_data, tvb, local_offset, 220, FALSE);
+ break;
+ case RMPP_ACK:
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_new_window_last, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved220, tvb, local_offset, 220, FALSE);
+ break;
+ case RMPP_STOP:
+ case RMPP_ABORT:
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(RMPP_header_tree, hf_infiniband_optional_extended_error_data, tvb, local_offset, 220, FALSE);
+ break;
+ default:
+ break;
+ }
+ *offset = local_offset;
+ return TRUE;
+}
+
+/* Parse the Method from the MAD Common Header.
+* Simply used to generate the identifier.
+* IN: SubMItem - the item to append the method label to.
+* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */
+static void label_SUBM_Method(proto_item *SubMItem, MAD_Data *MadHeader)
+{
+ switch(MadHeader->method)
+ {
+ case 0x01:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SubnGet(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnGet(");
+ break;
+ case 0x02:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SubnSet(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnSet(");
+ break;
+ case 0x81:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SubnGetResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnGetResp(");
+ break;
+ case 0x05:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SubnTrap(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnTrap(");
+ break;
+ case 0x07:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SubnTrapResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnTrapResp(");
+ break;
+ default:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "Unknown SubManagement Method!");
+ }
+ col_append_str(g_cinfo, COL_INFO, "Unknown SubManagement Method!");
+ break;
+ }
+}
+/* Parse the SA Method from the MAD Common Header.
+* Simply used to generate the identifier.
+* IN: SubAItem - the item to append the method label to.
+* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */
+static void label_SUBA_Method(proto_item *SubAItem, MAD_Data *MadHeader)
+{
+ switch(MadHeader->method)
+ {
+ case 0x01:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGet(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGet(");
+ break;
+ case 0x81:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGetResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGetResp(");
+ break;
+ case 0x02:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmSet(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmSet(");
+ break;
+ case 0x06:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmReport(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmReport(");
+ break;
+ case 0x86:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmReportResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmReportResp(");
+ break;
+ case 0x12:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGetTable(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGetTable(");
+ break;
+ case 0x92:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGetTableResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGetTableResp(");
+ break;
+ case 0x13:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGetTraceTable(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGetTraceTable(");
+ break;
+ case 0x14:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGetMulti(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGetMulti(");
+ break;
+ case 0x94:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmGetMultiResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmGetMultiResp(");
+ break;
+ case 0x15:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmDelete(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmDelete(");
+ break;
+ case 0x95:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "SubnAdmDeleteResp(");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SubnAdmDeleteResp(");
+ break;
+ default:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", "Unknown SubAdministration Method!");
+ }
+ col_append_str(g_cinfo, COL_INFO, "Unknown SubAdministration Method!");
+ break;
+ }
+}
+
+/* Parse the Attribute from the MAD Common Header
+* Simply used to generate the identifier.
+* IN: SubMItem - the item to append the Attribute label to.
+* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */
+static void label_SUBM_Attribute(proto_item *SubMItem, MAD_Data *MadHeader)
+{
+ switch(MadHeader->attributeID)
+ {
+ case 0x0002:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "Notice) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "Notice)");
+ break;
+ case 0x0010:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "NodeDescription) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "NodeDescription)");
+ break;
+ case 0x0011:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "NodeInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "NodeInfo)");
+ break;
+ case 0x0012:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SwitchInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SwitchInfo)");
+ break;
+ case 0x0014:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "GUIDInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "GUIDInfo)");
+ break;
+ case 0x0015:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "PortInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "PortInfo)");
+ break;
+ case 0x0016:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "P_KeyTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "P_KeyTable)");
+ break;
+ case 0x0017:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SLtoVLMappingTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SLtoVLMappingTable)");
+ break;
+ case 0x0018:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "VLArbitrationTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "VLArbitrationTable)");
+ break;
+ case 0x0019:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "LinearForwardingTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "LinearForwardingTable)");
+ break;
+ case 0x001A:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "RandomForwardingTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "RandomForwardingTable)");
+ break;
+ case 0x001B:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "MulticastForwardingTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "MulticastForwardingTable)");
+ break;
+ case 0x001C:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "LinkSpeedWidthPairsTable) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "LinkSpeedWidthPairsTable)");
+ break;
+ case 0x0020:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "SMinfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "SMinfo)");
+ break;
+ case 0x0030:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "VendorDiag) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "VendorDiag)");
+ break;
+ case 0x0031:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", "LedInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "LedInfo)");
+ break;
+ default:
+ if(SubMItem)
+ {
+ proto_item_append_text(SubMItem, "%s", " (Unknown SubManagement Attribute!) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(Unknown SubManagement Attribute!)");
+ break;
+ }
+}
+
+/* Parse the SA Attribute from the MAD Common Header
+* Simply used to generate the identifier.
+* IN: SubAItem - the item to append the Attribute label to.
+* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */
+static void label_SUBA_Attribute(proto_item *SubAItem, MAD_Data *MadHeader)
+{
+ switch(MadHeader->attributeID)
+ {
+ case 0x0001:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (ClassPortInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(ClassPortInfo)");
+ break;
+ case 0x0002:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (Notice) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(Notice)");
+ break;
+ case 0x0003:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (InformInfo) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(InformInfo)");
+ break;
+ case 0x0011:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (NodeRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(NodeRecord)");
+ break;
+ case 0x0012:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (PortInfoRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(PortInfoRecord)");
+ break;
+ case 0x0013:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (SLtoVLMappingTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(SLtoVLMappingTableRecord)");
+ break;
+ case 0x0014:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (SwitchInfoRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(SwitchInfoRecord)");
+ break;
+ case 0x0015:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (LinearForwardingTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(LinearForwardingTableRecord)");
+ break;
+ case 0x0016:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (RandomForwardingTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(RandomForwardingTableRecord)");
+ break;
+ case 0x0017:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (MulticastForwardingTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(MulticastForwardingTableRecord)");
+ break;
+ case 0x0018:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (SMInfoRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(SMInfoRecord)");
+ break;
+ case 0x0019:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (LinkSpeedWidthPairsTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(LinkSpeedWidthPairsTableRecord)");
+ break;
+ case 0x00F3:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (InformInfoRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(InformInfoRecord)");
+ break;
+ case 0x0020:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (LinkRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(LinkRecord)");
+ break;
+ case 0x0030:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (GuidInfoRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(GuidInfoRecord)");
+ break;
+ case 0x0031:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (ServiceRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(ServiceRecord)");
+ break;
+ case 0x0033:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (P_KeyTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(P_KeyTableRecord)");
+ break;
+ case 0x0035:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (PathRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(PathRecord)");
+ break;
+ case 0x0036:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (VLArbitrationTableRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(VLArbitrationTableRecord)");
+ break;
+ case 0x0038:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (MCMemberRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(MCMemberRecord)");
+ break;
+ case 0x0039:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (TraceRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(TraceRecord)");
+ break;
+ case 0x003A:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (MultiPathRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(MultiPathRecord)");
+ break;
+ case 0x003B:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (ServiceAssociationRecord) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(ServiceAssociationRecord)");
+ break;
+ default:
+ if(SubAItem)
+ {
+ proto_item_append_text(SubAItem, "%s", " (Unknown SubAdministration Attribute!) ");
+ }
+ col_append_str(g_cinfo, COL_INFO, "(Unknown SubAdministration Attribute!)");
+ break;
+ }
+}
+
+/* Parse the attribute from a Subnet Management Packet.
+* IN: Parent Tree to add the item to in the dissection tree
+* IN: tvbuff, offset - the data and where it is.
+* IN: MAD_Data the data from the Common MAD Header that provides the information we need */
+static gboolean parse_SUBM_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader)
+{
+ guint16 attributeID = MadHeader->attributeID;
+ proto_tree *SUBM_Attribute_header_tree = NULL;
+ proto_item *SUBM_Attribute_header_item = NULL;
+
+ SUBM_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, *offset, 64, FALSE);
+ proto_item_set_text(SUBM_Attribute_header_item, "%s", val_to_str(attributeID, SUBM_Attributes, "Unknown Attribute Type! (0x%02x)"));
+ SUBM_Attribute_header_tree = proto_item_add_subtree(SUBM_Attribute_header_item, ett_subm_attribute);
+
+
+ switch(attributeID)
+ {
+ case 0x0002:
+ parse_NoticesAndTraps(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0010:
+ parse_NodeDescription(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0011:
+ parse_NodeInfo(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0012:
+ parse_SwitchInfo(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0014:
+ parse_GUIDInfo(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0015:
+ parse_PortInfo(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0016:
+ parse_P_KeyTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0017:
+ parse_SLtoVLMappingTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0018:
+ parse_VLArbitrationTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0019:
+ parse_LinearForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x001A:
+ parse_RandomForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x001B:
+ parse_MulticastForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x001C:
+ parse_SMInfo(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0020:
+ parse_VendorDiag(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0030:
+ parse_LedInfo(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ case 0x0031:
+ parse_LinkSpeedWidthPairsTable(SUBM_Attribute_header_tree , tvb, offset);
+ break;
+ default:
+ break;
+ }
+
+
+ *offset += 64;
+ return TRUE;
+
+}
+/* Parse the attribute from a Subnet Administration Packet.
+* IN: Parent Tree to add the item to in the dissection tree
+* IN: tvbuff, offset - the data and where it is.
+* IN: MAD_Data the data from the Common MAD Header that provides the information we need */
+static gboolean parse_SUBA_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader)
+{
+ guint16 attributeID = MadHeader->attributeID;
+ proto_tree *SUBA_Attribute_header_tree = NULL;
+ proto_item *SUBA_Attribute_header_item = NULL;
+
+ SUBA_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, *offset, 200, FALSE);
+ proto_item_set_text(SUBA_Attribute_header_item, "%s", val_to_str(attributeID, SUBA_Attributes, "Unknown Attribute Type! (0x%02x)"));
+ SUBA_Attribute_header_tree = proto_item_add_subtree(SUBA_Attribute_header_item, ett_suba_attribute);
+
+ /* Skim off the RID fields should they be present */
+ parse_RID(SUBA_Attribute_header_tree, tvb, offset, MadHeader);
+
+ /* Parse the rest of the attributes */
+ switch(MadHeader->attributeID)
+ {
+ case 0x0001: /* (ClassPortInfo) */
+ parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0002: /* (Notice) */
+ parse_NoticesAndTraps(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0003: /* (InformInfo) */
+ parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0011: /* (NodeRecord) */
+ parse_NodeInfo(SUBA_Attribute_header_tree, tvb, offset);
+ *offset += 40;
+ parse_NodeDescription(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0012: /* (PortInfoRecord) */
+ parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0013: /* (SLtoVLMappingTableRecord) */
+ parse_SLtoVLMappingTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0014: /* (SwitchInfoRecord) */
+ parse_SwitchInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0015: /*(LinearForwardingTableRecord) */
+ parse_LinearForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0016: /* (RandomForwardingTableRecord) */
+ parse_RandomForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0017: /* (MulticastForwardingTableRecord) */
+ parse_MulticastForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0018: /* (SMInfoRecord) */
+ parse_SMInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0019: /* (LinkSpeedWidthPairsTableRecord) */
+ parse_LinkSpeedWidthPairsTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x00F3: /*(InformInfoRecord) */
+ parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0020: /* (LinkRecord) */
+ parse_LinkRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0030: /* (GuidInforecord) */
+ parse_GUIDInfo(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0031: /*(ServiceRecord) */
+ parse_ServiceRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0033: /* (P_KeyTableRecord) */
+ parse_P_KeyTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0035: /* (PathRecord) */
+ parse_PathRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0036: /* (VLArbitrationTableRecord) */
+ parse_VLArbitrationTable(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0038: /* (MCMemberRecord) */
+ parse_MCMemberRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x0039: /* (TraceRecord) */
+ parse_TraceRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x003A: /* (MultiPathRecord) */
+ parse_MultiPathRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ case 0x003B: /* (ServiceAssociationRecord) */
+ parse_ServiceAssociationRecord(SUBA_Attribute_header_tree, tvb, offset);
+ break;
+ default: /* (Unknown SubAdministration Attribute!) */
+ /* We've already labeled as unknown in item construction */
+ break;
+ }
+
+ *offset += 200;
+ return TRUE;
+}
+
+/* Subnet Management Attribute Parsing Methods.
+* Also Parsing for Attributes common to both SM/SA.
+* The Subnet Admin Parsing methods will call some of these methods when an attribute is present within an SA MAD
+*/
+
+
+/* Parse NoticeDataDetails Attribute Field
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* trapNumber - The Trap ID of the Trap Data being Dissected */
+
+static void parse_NoticeDataDetails(proto_tree* parentTree, tvbuff_t* tvb, gint *offset, guint16 trapNumber)
+{
+ gint local_offset = *offset;
+ proto_tree *DataDetails_header_tree = NULL;
+ proto_item *DataDetails_header_item = NULL;
+
+ if(!parentTree)
+ return;
+
+ DataDetails_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 54, FALSE);
+ DataDetails_header_tree = proto_item_add_subtree(DataDetails_header_item, ett_datadetails);
+
+
+ switch(trapNumber)
+ {
+ case 64:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 64 DataDetails");
+ local_offset +=6;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 65:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 65 DataDetails");
+ local_offset +=6;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 66:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 66 DataDetails");
+ local_offset +=6;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 67:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 67 DataDetails");
+ local_offset +=6;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 68:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 68 DataDetails");
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, FALSE);
+ break;
+ case 69:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 69 DataDetails");
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, FALSE);
+ break;
+ case 128:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 128 DataDetails");
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ break;
+ case 129:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 129 DataDetails");
+ local_offset += 2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
+ break;
+ case 130:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 130 DataDetails");
+ local_offset += 2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
+ break;
+ case 131:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 131 DataDetails");
+ local_offset += 2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
+ break;
+ case 144:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 144 DataDetails");
+ local_offset +=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_OtherLocalChanges, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_CAPABILITYMASK, tvb, local_offset, 4, FALSE); local_offset+=4;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkSpeecEnabledChange, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkWidthEnabledChange, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_NodeDescriptionChange, tvb, local_offset, 1, FALSE);
+ break;
+ case 145:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 145 DataDetails");
+ local_offset +=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset +=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SYSTEMIMAGEGUID, tvb, local_offset, 8, FALSE); local_offset+=8;
+ break;
+ case 256:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 256 DataDetails");
+ local_offset +=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRSLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_METHOD, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEMODIFIER, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_MKEY, tvb, local_offset, 8, FALSE); local_offset+=8;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNotice, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRPathTruncated, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRHopCount, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNoticeReturnPath, tvb, local_offset, 30, FALSE); local_offset+=30;
+ break;
+ case 257:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 257 DataDetails");
+ local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE);
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 258:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 258 DataDetails");
+ local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE);
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 259:
+ proto_item_set_text(DataDetails_header_item, "%s", "Trap 259 DataDetails");
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DataValid, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PKEY, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE);
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3;
+ local_offset +=1;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SWLIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
+ break;
+ default:
+ proto_item_set_text(DataDetails_header_item, "%s", "Vendor Specific Subnet Management Trap"); local_offset +=54;
+ break;
+ }
+
+}
+
+/* Parse NoticesAndTraps Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_NoticesAndTraps(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *NoticesAndTraps_header_tree = NULL;
+ proto_item *NoticesAndTraps_header_item = NULL;
+ guint16 trapNumber = tvb_get_ntohs(tvb, local_offset + 4);
+
+ if(!parentTree)
+ return;
+
+ NoticesAndTraps_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(NoticesAndTraps_header_item, "%s", val_to_str(trapNumber, Trap_Description, "Unknown or Vendor Specific Trap Number! (0x%02x)"));
+ NoticesAndTraps_header_tree = proto_item_add_subtree(NoticesAndTraps_header_item, ett_noticestraps);
+
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IsGeneric, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_Type, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ProducerTypeVendorID, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_TrapNumberDeviceID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeToggle, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeCount, tvb, local_offset, 2, FALSE); local_offset+=2;
+
+ parse_NoticeDataDetails(NoticesAndTraps_header_tree, tvb, &local_offset, trapNumber);
+ proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_DataDetails, tvb, local_offset, 54, FALSE); local_offset+=54;
+
+ /* Only Defined For GMPs not SMPs which is not part of this dissector phase
+ *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ClassTrapSpecificData, tvb, local_offset, 1, FALSE); local_offset+=1; */
+
+}
+
+/* Parse NodeDescription Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_NodeDescription(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *NodeDescription_header_tree = NULL;
+
+ if(!parentTree)
+ return;
+
+ NodeDescription_header_tree = parentTree;
+ proto_tree_add_item(NodeDescription_header_tree, hf_infiniband_NodeDescription_NodeString, tvb, local_offset, 64, FALSE);
+}
+
+/* Parse NodeInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_NodeInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *NodeInfo_header_tree = NULL;
+
+ if(!parentTree)
+ return;
+
+ NodeInfo_header_tree = parentTree;
+
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_BaseVersion, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_ClassVersion, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeType, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NumPorts, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_SystemImageGUID, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeGUID, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PortGUID, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PartitionCap, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_DeviceID, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_Revision, tvb, local_offset, 4, FALSE); local_offset +=4;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_LocalPortNum, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_VendorID, tvb, local_offset, 3, FALSE); local_offset +=3;
+
+}
+
+/* Parse SwitchInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_SwitchInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *SwitchInfo_header_tree = NULL;
+
+ if(!parentTree)
+ return;
+
+ SwitchInfo_header_tree = parentTree;
+
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_RandomFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_MulticastFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBTop, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultPort, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LifeTimeValue, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PortStateChange, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LIDsPerPort, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PartitionEnforcementCap, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_InboundEnforcementCap, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OutboundEnforcementCap, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawInboundCap, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawOutboundCap, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_EnhancedPortZero, tvb, local_offset, 1, FALSE); local_offset +=1;
+}
+
+/* Parse GUIDInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_GUIDInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *GUIDInfo_header_tree = NULL;
+ proto_item *tempItemLow = NULL;
+ gint i = 0;
+
+ if(!parentTree)
+ return;
+
+ GUIDInfo_header_tree = parentTree;
+
+ for(i = 0; i < 8; i++)
+ {
+ proto_tree_add_item(GUIDInfo_header_tree, hf_infiniband_GUIDInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ }
+
+}
+
+/* Parse PortInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_PortInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *PortInfo_header_tree = NULL;
+ proto_tree *PortInfo_CapabilityMask_tree = NULL;
+ proto_item *PortInfo_CapabilityMask_item = NULL;
+ proto_item *temp_item = NULL;
+ guint16 temp_val = 0;
+
+ if(!parentTree)
+ return;
+
+ PortInfo_header_tree = parentTree;
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_Key, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GidPrefix, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LID, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMLID, tvb, local_offset, 2, FALSE); local_offset +=2;
+
+ /* Capability Mask Flags */
+ PortInfo_CapabilityMask_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_CapabilityMask, tvb, local_offset, 4, FALSE);
+ PortInfo_CapabilityMask_tree = proto_item_add_subtree(PortInfo_CapabilityMask_item, ett_portinfo_capmask);
+
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SM, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_NoticeSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_TrapSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SMdisabled, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ReinitSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported, tvb, local_offset, 4, FALSE);
+ proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported, tvb, local_offset, 4, FALSE);
+ local_offset+=4;
+ /* End Capability Mask Flags */
+
+ /* Diag Code */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_DiagCode, tvb, local_offset, 2, FALSE);
+ temp_val = tvb_get_ntohs(tvb, local_offset);
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, DiagCode, "Reserved DiagCode! Possible Error"));
+ local_offset +=2;
+ /* End Diag Code */
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyLeasePeriod, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPortNum, tvb, local_offset, 1, FALSE); local_offset +=1;
+
+ /* LinkWidthEnabled */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthEnabled, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthEnabled, "Reserved LinkWidthEnabled Value! Possible Error"));
+ local_offset +=1;
+ /* End LinkWidthEnabled */
+
+ /* LinkWidthSupported */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthSupported, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthSupported, "Reserved LinkWidthSupported Value! Possible Error"));
+ local_offset +=1;
+ /* End LinkWidthSupported */
+
+ /* LinkWidthActive */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthActive, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthActive, "Reserved LinkWidthActive Value! Possible Error"));
+ local_offset +=1;
+ /* End LinkWidthActive */
+
+ /* LinkSpeedSupported */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedSupported, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x00F0;
+ temp_val = temp_val >> 4;
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedSupported, "Reserved LinkWidthSupported Value! Possible Error"));
+ /* End LinkSpeedSupported */
+
+ /* PortState */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortState, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x000F;
+ /*temp_val = temp_val >> 4 */
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortState, "Reserved PortState Value! Possible Error"));
+ local_offset +=1;
+ /* End PortState */
+
+ /* PortPhysicalState */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortPhysicalState, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x00F0;
+ temp_val = temp_val >> 4;
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortPhysicalState, "Reserved PortPhysicalState Value! Possible Error"));
+ /* End PortPhysicalState */
+
+ /* LinkDownDefaultState */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkDownDefaultState, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x000F;
+ /*temp_val = temp_val >> 4 */
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkDownDefaultState, "Reserved LinkDownDefaultState Value! Possible Error"));
+ local_offset +=1;
+ /* End LinkDownDefaultState */
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyProtectBits, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LMC, tvb, local_offset, 1, FALSE); local_offset +=1;
+
+ /* LinkSpeedActive */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedActive, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x00F0;
+ temp_val = temp_val >> 4;
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedActive, "Reserved LinkSpeedActive Value! Possible Error"));
+ /* End LinkSpeedActive */
+
+ /* LinkSpeedEnabled */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedEnabled, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x000F;
+ /*temp_val = temp_val >> 4 */
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedEnabled, "Reserved LinkSpeedEnabled Value! Possible Error"));
+ local_offset +=1;
+ /* End LinkSpeedEnabled */
+
+ /* NeighborMTU */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_NeighborMTU, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x00F0;
+ temp_val = temp_val >> 4;
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, NeighborMTU, "Reserved NeighborMTU Value! Possible Error"));
+
+ /* End NeighborMTU */
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMSL, tvb, local_offset, 1, FALSE); local_offset +=1;
+
+ /* VLCap */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLCap, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x00F0;
+ temp_val = temp_val >> 4;
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, VLCap, "Reserved VLCap Value! Possible Error"));
+
+ /* End VLCap */
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitType, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLHighLimit, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationHighCap, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationLowCap, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitTypeReply, tvb, local_offset, 1, FALSE);
+
+ /* MTUCap */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MTUCap, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x000F;
+ /*temp_val = temp_val >> 4 */
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, MTUCap, "Reserved MTUCap Value! Possible Error"));
+ local_offset +=1;
+ /* End MTUCap */
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLStallCount, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_HOQLife, tvb, local_offset, 1, FALSE); local_offset +=1;
+
+ /* OperationalVLs */
+ temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OperationalVLs, tvb, local_offset, 1, FALSE);
+ temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
+
+ /* 4 bit values = mask and shift */
+ temp_val = temp_val & 0x00F0;
+ temp_val = temp_val >> 4;
+
+ proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, OperationalVLs, "Reserved OperationalVLs Value! Possible Error"));
+ /* End OperationalVLs */
+
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementInbound, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementOutbound, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawInbound, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawOutbound, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_P_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_Q_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GUIDCap, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_ClientReregister, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_SubnetTimeOut, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_RespTimeValue, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPhyErrors, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OverrunErrors, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MaxCreditHint, tvb, local_offset, 2, FALSE); local_offset +=3; /* 2 + 1 Reserved */
+ proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkRoundTripLatency, tvb, local_offset, 3, FALSE); local_offset +=3;
+}
+
+/* Parse P_KeyTable Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_P_KeyTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ gint i = 0;
+ proto_tree *P_KeyTable_header_tree = NULL;
+ proto_item *P_KeyTable_header_item = NULL;
+ proto_item *tempItemLow = NULL;
+ proto_item *tempItemHigh = NULL;
+
+ if(!parentTree)
+ return;
+
+ P_KeyTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_P_KeyTable_P_KeyTableBlock, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(P_KeyTable_header_item, "%s", "P_KeyTable");
+ P_KeyTable_header_tree = proto_item_add_subtree(P_KeyTable_header_item, ett_pkeytable);
+
+ for(i = 0; i < 32; i++)
+ {
+ tempItemLow = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_MembershipType, tvb, local_offset, 1, FALSE);
+ tempItemHigh = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_P_KeyBase, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ proto_item_append_text(tempItemHigh,"(%u)", i+1);
+ }
+}
+
+/* Parse SLtoVLMappingTable Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_SLtoVLMappingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *SLtoVLMappingTable_header_tree = NULL;
+ proto_item *SLtoVLMappingTable_header_item = NULL;
+ proto_item *tempItemLow = NULL;
+ proto_item *tempItemHigh = NULL;
+ gint i = 0;
+
+ if(!parentTree)
+ return;
+
+ SLtoVLMappingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(SLtoVLMappingTable_header_item, "%s", "SLtoVLMappingTable");
+ SLtoVLMappingTable_header_tree = proto_item_add_subtree(SLtoVLMappingTable_header_item, ett_sltovlmapping);
+
+ for(i = 0; i < 8; i++)
+ {
+ tempItemLow = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits, tvb, local_offset, 1, FALSE);
+ tempItemHigh = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ proto_item_append_text(tempItemHigh,"(%u)", i+1);
+ }
+}
+
+/* Parse VLArbitrationTable Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_VLArbitrationTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ gint i = 0;
+ proto_tree *VLArbitrationTable_header_tree = NULL;
+ proto_item *VLArbitrationTable_header_item = NULL;
+ proto_item *tempItemLow = NULL;
+ proto_item *tempItemHigh = NULL;
+
+ if(!parentTree)
+ return;
+
+ VLArbitrationTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(VLArbitrationTable_header_item, "%s", "VLArbitrationTable");
+ VLArbitrationTable_header_tree = proto_item_add_subtree(VLArbitrationTable_header_item, ett_vlarbitrationtable);
+
+ for(i = 0; i < 32; i++)
+ {
+ tempItemLow = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_VL, tvb, local_offset, 1, FALSE); local_offset +=1;
+ tempItemHigh = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_Weight, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ proto_item_append_text(tempItemHigh,"(%u)", i);
+ }
+}
+
+/* Parse LinearForwardingTable Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_LinearForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint i = 0;
+ gint local_offset = *offset;
+ proto_tree *LinearForwardingTable_header_tree = NULL;
+ proto_item *LinearForwardingTable_header_item = NULL;
+ proto_item *tempItemLow = NULL;
+
+ if(!parentTree)
+ return;
+
+ LinearForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(LinearForwardingTable_header_item, "%s", "LinearForwardingTable");
+ LinearForwardingTable_header_tree = proto_item_add_subtree(LinearForwardingTable_header_item, ett_linearforwardingtable);
+
+ for(i = 0; i < 64; i++)
+ {
+ tempItemLow = proto_tree_add_item(LinearForwardingTable_header_tree, hf_infiniband_LinearForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ }
+}
+
+/* Parse RandomForwardingTable Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_RandomForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint i = 0;
+ gint local_offset = *offset;
+ proto_tree *RandomForwardingTable_header_tree = NULL;
+ proto_item *RandomForwardingTable_header_item = NULL;
+ proto_item *tempItemLow = NULL;
+
+ if(!parentTree)
+ return;
+
+ RandomForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(RandomForwardingTable_header_item, "%s", "RandomForwardingTable");
+ RandomForwardingTable_header_tree = proto_item_add_subtree(RandomForwardingTable_header_item, ett_randomforwardingtable);
+
+ for(i = 0; i < 16; i++)
+ {
+ tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LID, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Valid, tvb, local_offset, 1, FALSE);
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LMC, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ }
+}
+
+/* Parse NoticesAndTraps Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_MulticastForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint i = 0;
+ gint local_offset = *offset;
+ proto_tree *MulticastForwardingTable_header_tree = NULL;
+ proto_item *MulticastForwardingTable_header_item = NULL;
+ proto_item *tempItemLow = NULL;
+
+ if(!parentTree)
+ return;
+
+ MulticastForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(MulticastForwardingTable_header_item, "%s", "MulticastForwardingTable");
+ MulticastForwardingTable_header_tree = proto_item_add_subtree(MulticastForwardingTable_header_item, ett_multicastforwardingtable);
+
+ for(i = 0; i < 16; i++)
+ {
+ tempItemLow = proto_tree_add_item(MulticastForwardingTable_header_tree, hf_infiniband_MulticastForwardingTable_PortMask, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_item_append_text(tempItemLow, "(%u)", i);
+ }
+
+}
+
+/* Parse SMInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_SMInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *SMInfo_header_tree = NULL;
+ proto_item *SMInfo_header_item = NULL;
+
+ if(!parentTree)
+ return;
+
+ SMInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(SMInfo_header_item, "%s", "SMInfo");
+ SMInfo_header_tree = proto_item_add_subtree(SMInfo_header_item, ett_sminfo);
+
+ proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SM_Key, tvb, local_offset, 8, FALSE); local_offset +=8;
+ proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_ActCount, tvb, local_offset, 4, FALSE); local_offset +=4;
+ proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_Priority, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SMState, tvb, local_offset, 1, FALSE); local_offset +=1;
+}
+
+/* Parse VendorDiag Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_VendorDiag(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *VendorDiag_header_tree = NULL;
+ proto_item *VendorDiag_header_item = NULL;
+
+ if(!parentTree)
+ return;
+
+ VendorDiag_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(VendorDiag_header_item, "%s", "VendorDiag");
+ VendorDiag_header_tree = proto_item_add_subtree(VendorDiag_header_item, ett_vendordiag);
+
+ proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_NextIndex, tvb, local_offset, 2, FALSE); local_offset +=2;
+ proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_DiagData, tvb, local_offset, 62, FALSE); local_offset +=62;
+}
+
+/* Parse LedInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_LedInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *LedInfo_header_tree = NULL;
+ proto_item *LedInfo_header_item = NULL;
+
+ if(!parentTree)
+ return;
+
+ LedInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(LedInfo_header_item, "%s", "LedInfo");
+ LedInfo_header_tree = proto_item_add_subtree(LedInfo_header_item, ett_ledinfo);
+
+ proto_tree_add_item(LedInfo_header_tree, hf_infiniband_LedInfo_LedMask, tvb, local_offset, 1, FALSE);
+}
+
+/* Parse LinkSpeedWidthPairsTable Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_LinkSpeedWidthPairsTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *LinkSpeedWidthPairsTable_header_tree = NULL;
+ proto_item *LinkSpeedWidthPairsTable_header_item = NULL;
+
+ if(!parentTree)
+ return;
+
+ LinkSpeedWidthPairsTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(LinkSpeedWidthPairsTable_header_item, "%s", "LinkSpeedWidthPairsTable");
+ LinkSpeedWidthPairsTable_header_tree = proto_item_add_subtree(LinkSpeedWidthPairsTable_header_item, ett_linkspeedwidthpairs);
+
+ proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_NumTables, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_PortMask, tvb, local_offset, 32, FALSE); local_offset +=32;
+ proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive, tvb, local_offset, 1, FALSE); local_offset +=1;
+ proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen, tvb, local_offset, 1, FALSE); local_offset +=1;
+}
+
+/* Parse RID Field from Subnet Administraiton Packets.
+* IN: SA_header_tree - the dissection tree of the subnet admin attribute.
+* tvb - the packet buffer
+* MadHeader - the Common MAD header from this packet.
+* IN/OUT: offset - the current and updated offset in the packet buffer */
+static void parse_RID(proto_tree* SA_header_tree, tvbuff_t* tvb, gint *offset, MAD_Data* MadHeader)
+{
+ gint local_offset = *offset;
+ if(!SA_header_tree)
+ {
+ return;
+ }
+ switch(MadHeader->attributeID)
+ {
+ case 0x0011:
+ /* NodeRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=2; /* Reserved bits */
+ break;
+ case 0x0012:
+ /* PortInfoRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_EndportLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=1; /* Reserved bits */
+ break;
+ case 0x0013:
+ /* SLtoVLMappingTableRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_InputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=4; /* Reserved bits */
+ break;
+ case 0x0014:
+ /* SwitchInfoRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=2; /* Reserved bits */
+ break;
+ case 0x0015:
+ /* LinearForwardingTableRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=4; /* Reserved bits */
+ break;
+ case 0x0016:
+ /* RandomForwardingTableRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=4; /* Reserved bits */
+ break;
+ case 0x0017:
+ /* MulticastForwardingTableRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_Position, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_NineBit, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=4; /* Reserved bits */
+ break;
+ case 0x0036:
+ /*VLArbitrationTableRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=4; /* Reserved bits */
+ break;
+ case 0x0018:
+ /* SMInfoRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=2; /* Reserved bits */
+ break;
+ case 0x0033:
+ /* P_KeyTableRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=3; /* Reserved bits */
+ break;
+ case 0x00F3:
+ /* InformInfoRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_SubscriberGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_Enum, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=6; /* Reserved bits */
+ break;
+ case 0x0020:
+ /* LinkRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromPort, tvb, local_offset, 1, FALSE); local_offset+=1;
+ break;
+ case 0x0031:
+ /* ServiceRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceID, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceP_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=2;
+ break;
+ case 0x0038:
+ /* MCMemberRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_MGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_PortGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ break;
+ case 0x0030:
+ /* GuidInfoRecord */
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=2;
+ local_offset+=4;
+ break;
+ default:
+ break;
+ }
+
+ *offset = local_offset;
+}
+
+/* Parse InformInfo Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_InformInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *InformInfo_header_tree = NULL;
+ proto_item *InformInfo_header_item = NULL;
+ if(!parentTree)
+ {
+ return;
+ }
+ InformInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 36, FALSE);
+ proto_item_set_text(InformInfo_header_item, "%s", "InformInfo");
+ InformInfo_header_tree = proto_item_add_subtree(InformInfo_header_item, ett_informinfo);
+
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_GID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeBegin, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeEnd, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=2; /* Reserved Bits */
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_IsGeneric, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Subscribe, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Type, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_TrapNumberDeviceID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_QPN, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_RespTimeValue, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=1;
+ proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_ProducerTypeVendorID, tvb, local_offset, 3, FALSE); local_offset+=3;
+
+}
+/* Parse LinkRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_LinkRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *LinkRecord_header_tree = NULL;
+ proto_item *LinkRecord_header_item = NULL;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ LinkRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 3, FALSE);
+ proto_item_set_text(LinkRecord_header_item, "%s", "LinkRecord");
+ LinkRecord_header_tree = proto_item_add_subtree(LinkRecord_header_item, ett_linkrecord);
+
+ proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToPort, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToLID, tvb, local_offset, 2, FALSE); local_offset +=2;
+
+}
+/* Parse ServiceRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_ServiceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *ServiceRecord_header_tree = NULL;
+ proto_item *ServiceRecord_header_item = NULL;
+ proto_item *tempData = NULL;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ ServiceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 176, FALSE);
+ proto_item_set_text(ServiceRecord_header_item, "%s", "ServiceRecord");
+ ServiceRecord_header_tree = proto_item_add_subtree(ServiceRecord_header_item, ett_servicerecord);
+
+ proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceLease, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceKey, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceName, tvb, local_offset, 64, FALSE); local_offset+=64;
+
+ tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_item_append_text(tempData, "%s", "(ServiceData 8.1, 8.16)");
+ tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_item_append_text(tempData, "%s", "(ServiceData 16.1, 16.8)");
+ tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_item_append_text(tempData, "%s", "(ServiceData 32.1, 32.4)");
+ tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_item_append_text(tempData, "%s", "(ServiceData 64.1, 64.2)");
+
+}
+/* Parse PathRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_PathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *PathRecord_header_tree = NULL;
+ proto_item *PathRecord_header_item = NULL;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ PathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(PathRecord_header_item, "%s", "PathRecord");
+ PathRecord_header_tree = proto_item_add_subtree(PathRecord_header_item, ett_pathrecord);
+ local_offset += 8; /* Reserved Bits */
+
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RawTraffic, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Reversible, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_NumbPath, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SL, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTUSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RateSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Preference, tvb, local_offset, 1, FALSE); local_offset+=1;
+}
+/* Parse MCMemberRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_MCMemberRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *MCMemberRecord_header_tree = NULL;
+ proto_item *MCMemberRecord_header_item = NULL;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ MCMemberRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE);
+ proto_item_set_text(MCMemberRecord_header_item, "%s", "MCMemberRecord");
+ MCMemberRecord_header_tree = proto_item_add_subtree(MCMemberRecord_header_item, ett_mcmemberrecord);
+
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Q_Key, tvb, local_offset, 4, FALSE); local_offset+=4;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MLID, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTUSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_RateSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_SL, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Scope, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_JoinState, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_ProxyJoin, tvb, local_offset, 1, FALSE); local_offset+=3;
+
+}
+/* Parse TraceRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_TraceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *TraceRecord_header_tree = NULL;
+ proto_item *TraceRecord_header_item = NULL;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ TraceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 46, FALSE);
+ proto_item_set_text(TraceRecord_header_item, "%s", "TraceRecord");
+ TraceRecord_header_tree = proto_item_add_subtree(TraceRecord_header_item, ett_tracerecord);
+
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_GIDPrefix, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_IDGeneration, tvb, local_offset, 2, FALSE); local_offset+=2;
+ local_offset+=1; /* Reserved Bits */
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeType, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeID, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ChassisID, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPortID, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPortID, tvb, local_offset, 8, FALSE); local_offset+=8;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPort, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPort, tvb, local_offset, 1, FALSE); local_offset+=1;
+}
+/* Parse MultiPathRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_MultiPathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *MultiPathRecord_header_tree = NULL;
+ proto_item *MultiPathRecord_header_item = NULL;
+ proto_item *SDGID = NULL;
+ guint8 SDGIDCount = 0;
+ guint8 DGIDCount = 0;
+ guint32 i = 0;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ MultiPathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 200, FALSE);
+ proto_item_set_text(MultiPathRecord_header_item, "%s", "MultiPathRecord");
+ MultiPathRecord_header_tree = proto_item_add_subtree(MultiPathRecord_header_item, ett_multipathrecord);
+
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RawTraffic, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Reversible, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_NumbPath, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SL, tvb, local_offset, 2, FALSE); local_offset+=2;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTUSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RateSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1;
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=1; /* Reserved Bits */
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_IndependenceSelector, tvb, local_offset, 1, FALSE);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_GIDScope, tvb, local_offset, 1, FALSE); local_offset+=1;
+
+ SDGIDCount = tvb_get_guint8(tvb, local_offset);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SGIDCount, tvb, local_offset, 1, FALSE); local_offset+=1;
+ DGIDCount = tvb_get_guint8(tvb, local_offset);
+ proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_DGIDCount, tvb, local_offset, 1, FALSE); local_offset+=1;
+ local_offset+=7; /*Reserved Bits */
+
+ for(i = 0; i < SDGIDCount; i++)
+ {
+ SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_item_set_text(SDGID, "(%s%u)","SGID", i);
+ }
+ for(i = 0; i < DGIDCount; i++)
+ {
+ SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, FALSE); local_offset+=16;
+ proto_item_set_text(SDGID, "(%s%u)","DGID", i);
+ }
+}
+/* Parse ServiceAssociationRecord Attribute
+* IN: parentTree - The tree to add the dissection to
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* MadHeader - The common MAD header of the current SMP/SMA */
+static void parse_ServiceAssociationRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
+{
+ gint local_offset = *offset;
+ proto_tree *ServiceAssociationRecord_header_tree = NULL;
+ proto_item *ServiceAssociationRecord_header_item = NULL;
+
+ if(!parentTree)
+ {
+ return;
+ }
+
+ ServiceAssociationRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 80, FALSE);
+ proto_item_set_text(ServiceAssociationRecord_header_item, "%s", "ServiceAssociationRecord");
+ ServiceAssociationRecord_header_tree = proto_item_add_subtree(ServiceAssociationRecord_header_item, ett_serviceassocrecord);
+
+ proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceKey, tvb, local_offset, 16, FALSE); local_offset +=16;
+ proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceName, tvb, local_offset, 64, FALSE); local_offset +=64;
+}
+
+/* dissect_general_info
+* Used to extract very few values from the packet in the case that full dissection is disabled by the user.
+* IN:
+* tvb - The tvbbuff of packet data
+* offset - The offset in TVB where the attribute begins
+* pinfo - The packet info structure with column information */
+static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo)
+{
+ guint8 lnh_val = 0; /* The Link Next Header Value. Tells us which headers are coming */
+ gboolean bthFollows = 0; /* Tracks if we are parsing a BTH. This is a significant decision point */
+ guint8 virtualLane = 0; /* The Virtual Lane of the current Packet */
+ guint8 opCode = 0; /* OpCode from BTH header. */
+ gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
+ guint8 nxtHdr = 0; /* that must be available for that header. */
+ struct e_in6_addr SRCgid; /* Struct to display ipv6 Address */
+ struct e_in6_addr DSTgid; /* Struct to display ipv6 Address */
+ guint8 management_class = 0;
+ MAD_Data MadData;
+
+
+ virtualLane = tvb_get_guint8(tvb, offset);
+ virtualLane = virtualLane & 0xF0;
+ offset+=1;
+
+ /* Save Link Next Header... This tells us what the next header is. */
+ lnh_val = tvb_get_guint8(tvb, offset);
+ lnh_val = lnh_val & 0x03;
+ offset+=1;
+
+ /* Set destination in packet view. */
+ if (check_col(pinfo->cinfo, COL_DEF_DST))
+ {
+ col_set_str(pinfo->cinfo, COL_DEF_DST, "DLID: ");
+ col_set_fence(pinfo->cinfo, COL_DEF_DST);
+ col_set_str(pinfo->cinfo, COL_DEF_DST, tvb_bytes_to_str(tvb, offset, 2));
+ }
+ offset+=4;
+
+ /* Set Source in packet view. */
+ if (check_col(pinfo->cinfo, COL_DEF_SRC))
+ {
+ col_set_str(pinfo->cinfo, COL_DEF_SRC, "SLID: ");
+ col_set_fence(pinfo->cinfo, COL_DEF_SRC);
+ col_set_str(pinfo->cinfo, COL_DEF_SRC, tvb_bytes_to_str(tvb, offset, 2));
+ }
+ offset+=2;
+
+ switch(lnh_val)
+ {
+ case IBA_GLOBAL:
+ offset +=6;
+ nxtHdr = tvb_get_guint8(tvb, offset);
+ offset += 2;
+
+ tvb_get_ipv6(tvb, offset, &SRCgid);
+ if (check_col(pinfo->cinfo, COL_DEF_SRC))
+ {
+ col_set_str(pinfo->cinfo, COL_DEF_SRC, "SGID: ");
+ col_set_fence(pinfo->cinfo, COL_DEF_SRC);
+ col_set_str(pinfo->cinfo, COL_DEF_SRC, ip6_to_str(&SRCgid));
+ }
+ offset += 16;
+
+ tvb_get_ipv6(tvb, offset, &DSTgid);
+ if (check_col(pinfo->cinfo, COL_DEF_DST))
+ {
+ col_set_str(pinfo->cinfo, COL_DEF_DST, "DGID: ");
+ col_set_fence(pinfo->cinfo, COL_DEF_DST);
+ col_set_str(pinfo->cinfo, COL_DEF_DST, ip6_to_str(&DSTgid));
+ }
+ offset += 16;
+
+ if(nxtHdr != 0x1B)
+ {
+ /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
+ break;
+ }
+ /* else
+ * {
+ * Fall through switch and start parsing Local Headers and BTH
+ * }
+ */
+ case IBA_LOCAL:
+ bthFollows = TRUE;
+
+ /* Get the OpCode - this tells us what headers are following */
+ opCode = tvb_get_guint8(tvb, offset);
+ if (check_col(pinfo->cinfo, COL_INFO))
+ {
+ col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
+ }
+ offset +=12;
+ break;
+ case IP_NON_IBA:
+ /* Raw IPv6 Packet */
+ if (check_col(pinfo->cinfo, COL_DEF_DST))
+ {
+ col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet");
+ col_set_fence(pinfo->cinfo, COL_DEF_DST);
+ }
+ break;
+ case RAW:
+ break;
+ default:
+ break;
+ }
+
+ if(bthFollows)
+ {
+ /* Find our next header sequence based on the Opcode
+ * Since we're not doing dissection here, we just need the proper offsets to get our labels in packet view */
+
+ nextHeaderSequence = find_next_header_sequence((guint32) opCode);
+ switch(nextHeaderSequence)
+ {
+ case RDETH_DETH_PAYLD:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ break;
+ case RDETH_DETH_RETH_PAYLD:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ offset += 16; /* RETH */
+ break;
+ case RDETH_DETH_IMMDT_PAYLD:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ offset += 4; /* IMMDT */
+ break;
+ case RDETH_DETH_RETH_IMMDT_PAYLD:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ offset += 16; /* RETH */
+ offset += 4; /* IMMDT */
+ break;
+ case RDETH_DETH_RETH:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ offset += 16; /* RETH */
+ break;
+ case RDETH_AETH_PAYLD:
+ offset += 4; /* RDETH */
+ offset += 4; /* AETH */
+ break;
+ case RDETH_PAYLD:
+ offset += 4; /* RDETH */
+ break;
+ case RDETH_AETH:
+ offset += 4; /* RDETH */
+ offset += 4; /* AETH */
+ break;
+ case RDETH_AETH_ATOMICACKETH:
+ offset += 4; /* RDETH */
+ offset += 4; /* AETH */
+ offset += 8; /* AtomicAckETH */
+ break;
+ case RDETH_DETH_ATOMICETH:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ offset += 28; /* AtomicETH */
+ break;
+ case RDETH_DETH:
+ offset += 4; /* RDETH */
+ offset += 8; /* DETH */
+ break;
+ case DETH_PAYLD:
+ offset += 8; /* DETH */
+ break;
+ case PAYLD:
+ break;
+ case IMMDT_PAYLD:
+ offset += 4; /* IMMDT */
+ break;
+ case RETH_PAYLD:
+ offset += 16; /* RETH */
+ break;
+ case RETH:
+ offset += 16; /* RETH */
+ break;
+ case AETH_PAYLD:
+ offset += 4; /* AETH */
+ break;
+ case AETH:
+ offset += 4; /* AETH */
+ break;
+ case AETH_ATOMICACKETH:
+ offset += 4; /* AETH */
+ offset += 8; /* AtomicAckETH */
+ break;
+ case ATOMICETH:
+ offset += 28; /* AtomicETH */
+ break;
+ case IETH_PAYLD:
+ offset += 4; /* IETH */
+ break;
+ case DETH_IMMDT_PAYLD:
+ offset += 8; /* DETH */
+ offset += 4; /* IMMDT */
+ break;
+ default:
+ break;
+ }
+ }
+ if(virtualLane == 0xF0)
+ {
+ management_class = tvb_get_guint8(tvb, offset + 1);
+ if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END))
+ || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END)))
+ {
+ return;
+ }
+ else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END))
+ {
+ return;
+ }
+ else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02))
+ || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80))
+ || ((management_class >= (guint8)0x82)))
+ {
+ return;
+ }
+ else /* we have a normal management_class */
+ {
+ parse_MAD_Common(NULL, tvb, &offset, &MadData);
+ label_SUBM_Method(NULL, &MadData);
+ label_SUBM_Attribute(NULL, &MadData);
+ }
+ }
+
+ return;
+}
#define PROTO_TAG_INFINIBAND "Infiniband"
+#include <epan/etypes.h>
+
/* Wireshark ID */
static int proto_infiniband = -1;
-/*static int hf_infiniband_pdu_type = -1; unnecessary for now */
+
+/* Variables to hold expansion values between packets */
static gint ett_infiniband = -1;
+static gint ett_all_headers = -1;
+static gint ett_lrh = -1;
+static gint ett_grh = -1;
+static gint ett_bth = -1;
+static gint ett_rwh = -1;
+static gint ett_rawdata = -1;
+static gint ett_rdeth = -1;
+static gint ett_deth = -1;
+static gint ett_reth = -1;
+static gint ett_atomiceth = -1;
+static gint ett_aeth = -1;
+static gint ett_atomicacketh = -1;
+static gint ett_immdt = -1;
+static gint ett_ieth = -1;
+static gint ett_payload = -1;
+static gint ett_vendor = -1;
+static gint ett_subn_lid_routed = -1;
+static gint ett_subn_directed_route = -1;
+static gint ett_subnadmin = -1;
+static gint ett_mad = -1;
+static gint ett_rmpp = -1;
+static gint ett_subm_attribute = -1;
+static gint ett_suba_attribute = -1;
+static gint ett_datadetails = -1;
+static gint ett_noticestraps = -1;
+static gint ett_nodedesc = -1;
+static gint ett_nodeinfo = -1;
+static gint ett_switchinfo = -1;
+static gint ett_guidinfo = -1;
+static gint ett_portinfo = -1;
+static gint ett_portinfo_capmask = -1;
+static gint ett_pkeytable = -1;
+static gint ett_sltovlmapping = -1;
+static gint ett_vlarbitrationtable = -1;
+static gint ett_linearforwardingtable = -1;
+static gint ett_randomforwardingtable = -1;
+static gint ett_multicastforwardingtable = -1;
+static gint ett_sminfo = -1;
+static gint ett_vendordiag = -1;
+static gint ett_ledinfo = -1;
+static gint ett_linkspeedwidthpairs = -1;
+static gint ett_informinfo = -1;
+static gint ett_linkrecord = -1;
+static gint ett_servicerecord = -1;
+static gint ett_pathrecord = -1;
+static gint ett_mcmemberrecord = -1;
+static gint ett_tracerecord = -1;
+static gint ett_multipathrecord = -1;
+static gint ett_serviceassocrecord = -1;
+/* Static ref to column_info for dissection */
+static column_info *g_cinfo = NULL;
+static packet_info *g_pinfo = NULL;
+/* Global ref to highest level tree should we find other protocols encapsulated in IB */
+static proto_tree *top_tree = NULL;
+
+/* MAD_Data
+* Structure to hold information from the common MAD header.
+* This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */
+typedef struct {
+ guint8 managementClass;
+ guint8 classVersion;
+ guint8 method;
+ guint8 status;
+ guint16 classSpecific;
+ guint64 transactionID;
+ guint16 attributeID;
+ guint32 attributeModifier;
+ char data[232];
+} MAD_Data;
/* Dissector Declarations */
static dissector_handle_t infiniband_handle;
+static dissector_handle_t ipv6_handle;
+static dissector_handle_t ip_handle;
+static dissector_handle_t arp_handle;
+static dissector_handle_t rarp_handle;
+static dissector_handle_t data_handle;
+static dissector_table_t ethertype_dissector_table;
+
void proto_register_infiniband(void);
void proto_reg_handoff_infiniband(void);
static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree);
static gint32 find_next_header_sequence(guint32 OpCode);
static gboolean contains(guint32 value, guint32* arr, int length);
+static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo);
/* Parsing Methods for specific IB headers. */
-static void parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_PAYLOAD(proto_tree * parentTree, tvbuff_t *tvb, gint *offset, gint length);
-static void parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-static void parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset);
-
-/* These are not currently used, but in the future */
-/* can be expanded and used to provide better visualization in Wireshark. */
-static const value_string packettypenames[] =
-{
- { 4, "Local" },
- { 3, "Global" },
- { 2, "Raw (Raw Header)" },
- { 1, "Raw (IPv6 Header)"},
+static void parse_VENDOR(proto_tree *, tvbuff_t *, gint *);
+static void parse_PAYLOAD(proto_tree *, tvbuff_t *, gint *, gint length, guint8 virtualLane);
+static void parse_IETH(proto_tree *, tvbuff_t *, gint *);
+static void parse_IMMDT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_ATOMICACKETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_AETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_ATOMICETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_RETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_DETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_RDETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_IPvSix(proto_tree *, tvbuff_t *, gint *offset, packet_info *pinfo);
+static void parse_RWH(proto_tree *, tvbuff_t *, gint *offset, packet_info *pinfo);
+
+static void parse_SUBN_LID_ROUTED(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_SUBN_DIRECTED_ROUTE(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_SUBNADMN(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_PERF(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_BM(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_DEV_MGT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_COM_MGT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_SNMP(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_VENDOR_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_APPLICATION_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_RESERVED_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
+
+static gboolean parse_MAD_Common(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+static gboolean parse_RMPP(proto_tree* , tvbuff_t* , gint *offset);
+static void label_SUBM_Method(proto_item*, MAD_Data*);
+static void label_SUBM_Attribute(proto_item*, MAD_Data*);
+static void label_SUBA_Method(proto_item*, MAD_Data*);
+static void label_SUBA_Attribute(proto_item*, MAD_Data*);
+
+/* Class Attribute Parsing Routines */
+static gboolean parse_SUBM_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+static gboolean parse_SUBA_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+
+/* These methods parse individual attributes
+* Naming convention FunctionHandle = "parse_" + [Attribute Name];
+* Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification
+* Subnet Management */
+static void parse_NoticesAndTraps(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_NodeDescription(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_NodeInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_SwitchInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_GUIDInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_PortInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_P_KeyTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_SLtoVLMappingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_VLArbitrationTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LinearForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_RandomForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_MulticastForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_SMInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_VendorDiag(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LedInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LinkSpeedWidthPairsTable(proto_tree*, tvbuff_t*, gint *offset);
+
+/* Subnet Administration */
+static void parse_InformInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LinkRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_ServiceRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_PathRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_MCMemberRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_TraceRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_MultiPathRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_ServiceAssociationRecord(proto_tree*, tvbuff_t*, gint *offset);
+
+/* Subnet Administration */
+static void parse_RID(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+
+/* SM Attributes */
+static const value_string SUBM_Attributes[] = {
+ { 0x0001, "Attribute (ClassPortInfo)"},
+ { 0x0002, "Attribute (Notice)"},
+ { 0x0003, "Attribute (InformInfo)"},
+ { 0x0010, "Attribute (NodeDescription)"},
+ { 0x0011, "Attribute (NodeInfo)"},
+ { 0x0012, "Attribute (SwitchInfo)"},
+ { 0x0014, "Attribute (GUIDInfo)"},
+ { 0x0015, "Attribute (PortInfo)"},
+ { 0x0016, "Attribute (P_KeyTable)"},
+ { 0x0017, "Attribute (SLtoVLMapptingTable)"},
+ { 0x0018, "Attribute (VLArbitrationTable)"},
+ { 0x0019, "Attribute (LinearForwardingTable)"},
+ { 0x001A, "Attribute (RandomForwardingTable)"},
+ { 0x001B, "Attribute (MulticastForwardingTable)"},
+ { 0x001C, "Attribute (LinkSpeedWidthPairsTable)"},
+ { 0x0020, "Attribute (SMInfo)"},
+ { 0x0030, "Attribute (VendorDiag)"},
+ { 0x0031, "Attribute (LedInfo)"}
+};
+/* SA Attributes */
+static const value_string SUBA_Attributes[] = {
+ { 0x0001, "Attribute (ClassPortInfo)"},
+ { 0x0002, "Attribute (Notice)"},
+ { 0x0003, "Attribute (InformInfo)"},
+ { 0x0011, "Attribute (NodeRecord)"},
+ { 0x0012, "Attribute (PortInfoRecord)"},
+ { 0x0013, "Attribute (SLtoVLMappingTableRecord)"},
+ { 0x0014, "Attribute (SwitchInfoRecord)"},
+ { 0x0015, "Attribute (LinearForwardingTableRecord)"},
+ { 0x0016, "Attribute (RandomForwardingTableRecord)"},
+ { 0x0017, "Attribute (MulticastForwardingTableRecord)"},
+ { 0x0018, "Attribute (SMInfoRecord)"},
+ { 0x0019, "Attribute (LinkSpeedWidthPairsTableRecord)"},
+ { 0x00F3, "Attribute (InformInfoRecord)"},
+ { 0x0020, "Attribute (LinkRecord)"},
+ { 0x0030, "Attribute (GuidInfoRecord)"},
+ { 0x0031, "Attribute (ServiceRecord)"},
+ { 0x0033, "Attribute (P_KeyTableRecord)"},
+ { 0x0035, "Attribute (PathRecord)"},
+ { 0x0036, "Attribute (VLArbitrationTableRecord)"},
+ { 0x0038, "Attribute (MCMembersRecord)"},
+ { 0x0039, "Attribute (TraceRecord)"},
+ { 0x003A, "Attribute (MultiPathRecord)"},
+ { 0x003B, "Attribute (ServiceAssociationRecord)"}
+};
+
+
+/* RMPP Types */
+#define RMPP_ILLEGAL 0
+#define RMPP_DATA 1
+#define RMPP_ACK 2
+#define RMPP_STOP 3
+#define RMPP_ABORT 4
+
+static const value_string RMPP_Packet_Types[] = {
+ { RMPP_ILLEGAL, " Illegal RMPP Type (0)! " },
+ { RMPP_DATA, "RMPP (DATA)" },
+ { RMPP_ACK, "RMPP (ACK)" },
+ { RMPP_STOP, "RMPP (STOP)" },
+ { RMPP_ABORT, "RMPP (ABORT)" }
+};
+
+static const value_string RMPP_Flags[] = {
+ { 3, " (Transmission Sequence - First Packet)"},
+ { 5, " (Transmission Sequence - Last Packet)"},
+ { 1, " (Transmission Sequence) " },
{ 0, NULL}
};
-/* Just a map so we can display a value for FT_BOOLEAN types */
+static const value_string RMPP_Status[]= {
+ { 0, " (Normal)"},
+ { 1, " (Resources Exhausted)"},
+ { 118, " (Total Time Too Long)"},
+ { 119, " (Inconsistent Last and PayloadLength)"},
+ { 120, " (Inconsistent First and Segment Number)"},
+ { 121, " (Bad RMPPType)"},
+ { 122, " (NewWindowLast Too Small)"},
+ { 123, " (SegmentNumber Too Big)"},
+ { 124, " (Illegal Status)"},
+ { 125, " (Unsupported Version)"},
+ { 126, " (Too Many Retries)"},
+ { 127, " (Unspecified - Unknown Error Code on ABORT)"}
+};
-static const value_string IB_Boolean[] = {
- { 0, " 0 " },
- { 1, " 1 " },
- { 2, NULL }
+static const value_string DiagCode[]= {
+ {0x0000, "Function Ready"},
+ {0x0001, "Performing Self Test"},
+ {0x0002, "Initializing"},
+ {0x0003, "Soft Error - Function has non-fatal error"},
+ {0x0004, "Hard Error - Function has fatal error"}
};
-
+static const value_string LinkWidthEnabled[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "1x"},
+ {0x0002, "4x"},
+ {0x0003, "1x or 4x"},
+ {0x0004, "8x"},
+ {0x0005, "1x or 8x"},
+ {0x0006, "4x or 8x"},
+ {0x0007, "1x or 4x or 8x"},
+ {0x0008, "12x"},
+ {0x0009, "1x or 12x"},
+ {0x000A, "4x or 12x"},
+ {0x000B, "1x or 4x or 12x"},
+ {0x000C, "8x or 12x"},
+ {0x000D, "1x or 8x or 12x"},
+ {0x000E, "4x or 8x or 12x"},
+ {0x000E, "1x or 4x or 8x or 12x"},
+ {0x00FF, "Set to LinkWidthSupported Value - Response contains actual LinkWidthSupported"}
+};
+
+static const value_string LinkWidthSupported[]= {
+ {0x0001, "1x"},
+ {0x0003, "1x or 4x"},
+ {0x0007, "1x or 4x or 8x"},
+ {0x000B, "1x or 4x or 12x"},
+ {0x000F, "1x or 4x or 8x or 12x"}
+};
+static const value_string LinkWidthActive[]= {
+ {0x0001, "1x"},
+ {0x0002, "4x"},
+ {0x0004, "8x"},
+ {0x0008, "12x"}
+};
+static const value_string LinkSpeedSupported[]= {
+ {0x0001, "2.5 Gbps"},
+ {0x0003, "2.5 or 5.0 Gbps"},
+ {0x0005, "2.5 or 10.0 Gbps"},
+ {0x0007, "2.5 or 5.0 or 10.0 Gbps"},
+};
+static const value_string PortState[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "Down (includes failed links)"},
+ {0x0002, "Initialized"},
+ {0x0003, "Armed"},
+ {0x0004, "Active"}
+};
+static const value_string PortPhysicalState[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "Sleep"},
+ {0x0002, "Polling"},
+ {0x0003, "Disabled"},
+ {0x0004, "PortConfigurationTraining"},
+ {0x0005, "LinkUp"},
+ {0x0006, "LinkErrorRecovery"},
+ {0x0007, "Phy Test"}
+};
+static const value_string LinkDownDefaultState[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "Sleep"},
+ {0x0002, "Polling"}
+};
+static const value_string LinkSpeedActive[]= {
+ {0x0001, "2.5 Gbps"},
+ {0x0002, "5.0 Gbps"},
+ {0x0004, "10.0 Gbps"}
+};
+static const value_string LinkSpeedEnabled[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "2.5 Gbps"},
+ {0x0003, "2.5 or 5.0 Gbps"},
+ {0x0005, "2.5 or 10.0 Gbps"},
+ {0x0007, "2.5 or 5.0 or 10.0 Gbps"},
+ {0x000F, "Set to LinkSpeedSupported value - response contains actual LinkSpeedSupported"}
+};
+static const value_string NeighborMTU[]= {
+ {0x0001, "256"},
+ {0x0002, "512"},
+ {0x0003, "1024"},
+ {0x0004, "2048"},
+ {0x0005, "4096"}
+};
+static const value_string VLCap[]= {
+ {0x0001, "VL0"},
+ {0x0002, "VL0, VL1"},
+ {0x0003, "VL0 - VL3"},
+ {0x0004, "VL0 - VL7"},
+ {0x0005, "VL0 - VL14"}
+};
+static const value_string MTUCap[]= {
+ {0x0001, "256"},
+ {0x0002, "512"},
+ {0x0003, "1024"},
+ {0x0004, "2048"},
+ {0x0005, "4096"}
+};
+static const value_string OperationalVLs[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "VL0"},
+ {0x0002, "VL0, VL1"},
+ {0x0003, "VL0 - VL3"},
+ {0x0004, "VL0 - VL7"},
+ {0x0005, "VL0 - VL14"}
+};
+
/* Local Route Header (LRH) */
static int hf_infiniband_LRH = -1;
static int hf_infiniband_virtual_lane = -1;
static int hf_infiniband_acknowledge_request = -1;
static int hf_infiniband_reserved7 = -1;
static int hf_infiniband_packet_sequence_number = -1;
+/* Raw Header (RWH) */
+static int hf_infiniband_RWH = -1;
+static int hf_infiniband_reserved16_RWH = -1;
+static int hf_infiniband_etype = -1;
/* Reliable Datagram Extended Transport Header (RDETH) */
static int hf_infiniband_RDETH = -1;
static int hf_infiniband_reserved8_RDETH = -1;
/* Unknown or Vendor Specific */
static int hf_infiniband_raw_data = -1;
static int hf_infiniband_vendor = -1;
+/* MAD Base Header */
+static int hf_infiniband_MAD = -1;
+static int hf_infiniband_base_version = -1;
+static int hf_infiniband_mgmt_class = -1;
+static int hf_infiniband_class_version = -1;
+static int hf_infiniband_reserved1 = -1;
+static int hf_infiniband_method = -1;
+static int hf_infiniband_status = -1;
+static int hf_infiniband_class_specific = -1;
+static int hf_infiniband_transaction_id = -1;
+static int hf_infiniband_attribute_id = -1;
+static int hf_infiniband_reserved16 = -1;
+static int hf_infiniband_attribute_modifier = -1;
+static int hf_infiniband_data = -1;
+/* RMPP Header */
+static int hf_infiniband_RMPP = -1;
+static int hf_infiniband_rmpp_version = -1;
+static int hf_infiniband_rmpp_type = -1;
+static int hf_infiniband_r_resp_time = -1;
+static int hf_infiniband_rmpp_flags = -1;
+static int hf_infiniband_rmpp_status = -1;
+static int hf_infiniband_rmpp_data1 = -1;
+static int hf_infiniband_rmpp_data2 = -1;
+/* RMPP Data */
+static int hf_infiniband_RMPP_DATA = -1;
+static int hf_infiniband_segment_number = -1;
+static int hf_infiniband_payload_length32 = -1;
+static int hf_infiniband_transferred_data = -1;
+/* RMPP ACK */
+static int hf_infiniband_new_window_last = -1;
+static int hf_infiniband_reserved220 = -1;
+/* RMPP ABORT and STOP */
+static int hf_infiniband_reserved32 = -1;
+static int hf_infiniband_optional_extended_error_data = -1;
+/* SMP Data LID Routed */
+static int hf_infiniband_SMP_LID = -1;
+static int hf_infiniband_m_key = -1;
+static int hf_infiniband_smp_data = -1;
+static int hf_infiniband_reserved1024 = -1;
+static int hf_infiniband_reserved256 = -1;
+/* SMP Data Directed Route */
+static int hf_infiniband_SMP_DIRECTED = -1;
+static int hf_infiniband_smp_status = -1;
+static int hf_infiniband_hop_pointer = -1;
+static int hf_infiniband_hop_count = -1;
+static int hf_infiniband_dr_slid = -1;
+static int hf_infiniband_dr_dlid = -1;
+static int hf_infiniband_reserved28 = -1;
+static int hf_infiniband_d = -1;
+static int hf_infiniband_initial_path = -1;
+static int hf_infiniband_return_path = -1;
+/* SA MAD Header */
+static int hf_infiniband_SA = -1;
+static int hf_infiniband_sm_key = -1;
+static int hf_infiniband_attribute_offset = -1;
+static int hf_infiniband_component_mask = -1;
+static int hf_infiniband_subnet_admin_data = -1;
+
+/* Attributes
+* Additional Structures for individuala attribute decoding.
+* Since they are not headers the naming convention is slightly modified
+* Convention: hf_infiniband_[attribute name]_[field]
+* This was not entirely necessary but I felt the previous convention
+* did not provide adequate readability for the granularity of attribute/attribute fields. */
+
+/* NodeDescription */
+static int hf_infiniband_NodeDescription_NodeString = -1;
+/* NodeInfo */
+static int hf_infiniband_NodeInfo_BaseVersion = -1;
+static int hf_infiniband_NodeInfo_ClassVersion = -1;
+static int hf_infiniband_NodeInfo_NodeType = -1;
+static int hf_infiniband_NodeInfo_NumPorts = -1;
+static int hf_infiniband_NodeInfo_SystemImageGUID = -1;
+static int hf_infiniband_NodeInfo_NodeGUID = -1;
+static int hf_infiniband_NodeInfo_PortGUID = -1;
+static int hf_infiniband_NodeInfo_PartitionCap = -1;
+static int hf_infiniband_NodeInfo_DeviceID = -1;
+static int hf_infiniband_NodeInfo_Revision = -1;
+static int hf_infiniband_NodeInfo_LocalPortNum = -1;
+static int hf_infiniband_NodeInfo_VendorID = -1;
+/* SwitchInfo */
+static int hf_infiniband_SwitchInfo_LinearFDBCap = -1;
+static int hf_infiniband_SwitchInfo_RandomFDBCap = -1;
+static int hf_infiniband_SwitchInfo_MulticastFDBCap = -1;
+static int hf_infiniband_SwitchInfo_LinearFDBTop = -1;
+static int hf_infiniband_SwitchInfo_DefaultPort = -1;
+static int hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort = -1;
+static int hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort = -1;
+static int hf_infiniband_SwitchInfo_LifeTimeValue = -1;
+static int hf_infiniband_SwitchInfo_PortStateChange = -1;
+static int hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming = -1;
+static int hf_infiniband_SwitchInfo_LIDsPerPort = -1;
+static int hf_infiniband_SwitchInfo_PartitionEnforcementCap = -1;
+static int hf_infiniband_SwitchInfo_InboundEnforcementCap = -1;
+static int hf_infiniband_SwitchInfo_OutboundEnforcementCap = -1;
+static int hf_infiniband_SwitchInfo_FilterRawInboundCap = -1;
+static int hf_infiniband_SwitchInfo_FilterRawOutboundCap = -1;
+static int hf_infiniband_SwitchInfo_EnhancedPortZero = -1;
+/* GUIDInfo */
+static int hf_infiniband_GUIDInfo_GUIDBlock = -1;
+static int hf_infiniband_GUIDInfo_GUID = -1;
+/* PortInfo */
+static int hf_infiniband_PortInfo_GidPrefix = -1;
+static int hf_infiniband_PortInfo_LID = -1;
+static int hf_infiniband_PortInfo_MasterSMLID = -1;
+static int hf_infiniband_PortInfo_CapabilityMask = -1;
+
+/* Capability Mask Flags */
+static int hf_infiniband_PortInfo_CapabilityMask_SM;
+static int hf_infiniband_PortInfo_CapabilityMask_NoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_TrapSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SMdisabled = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_ReinitSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported = -1;
+/* End Capability Mask Flags */
+
+
+static int hf_infiniband_PortInfo_DiagCode = -1;
+static int hf_infiniband_PortInfo_M_KeyLeasePeriod = -1;
+static int hf_infiniband_PortInfo_LocalPortNum = -1;
+static int hf_infiniband_PortInfo_LinkWidthEnabled = -1;
+static int hf_infiniband_PortInfo_LinkWidthSupported = -1;
+static int hf_infiniband_PortInfo_LinkWidthActive = -1;
+static int hf_infiniband_PortInfo_LinkSpeedSupported = -1;
+static int hf_infiniband_PortInfo_PortState = -1;
+static int hf_infiniband_PortInfo_PortPhysicalState = -1;
+static int hf_infiniband_PortInfo_LinkDownDefaultState = -1;
+static int hf_infiniband_PortInfo_M_KeyProtectBits = -1;
+static int hf_infiniband_PortInfo_LMC = -1;
+static int hf_infiniband_PortInfo_LinkSpeedActive = -1;
+static int hf_infiniband_PortInfo_LinkSpeedEnabled = -1;
+static int hf_infiniband_PortInfo_NeighborMTU = -1;
+static int hf_infiniband_PortInfo_MasterSMSL = -1;
+static int hf_infiniband_PortInfo_VLCap = -1;
+static int hf_infiniband_PortInfo_M_Key = -1;
+static int hf_infiniband_PortInfo_InitType = -1;
+static int hf_infiniband_PortInfo_VLHighLimit = -1;
+static int hf_infiniband_PortInfo_VLArbitrationHighCap = -1;
+static int hf_infiniband_PortInfo_VLArbitrationLowCap = -1;
+static int hf_infiniband_PortInfo_InitTypeReply = -1;
+static int hf_infiniband_PortInfo_MTUCap = -1;
+static int hf_infiniband_PortInfo_VLStallCount = -1;
+static int hf_infiniband_PortInfo_HOQLife = -1;
+static int hf_infiniband_PortInfo_OperationalVLs = -1;
+static int hf_infiniband_PortInfo_PartitionEnforcementInbound = -1;
+static int hf_infiniband_PortInfo_PartitionEnforcementOutbound = -1;
+static int hf_infiniband_PortInfo_FilterRawInbound = -1;
+static int hf_infiniband_PortInfo_FilterRawOutbound = -1;
+static int hf_infiniband_PortInfo_M_KeyViolations = -1;
+static int hf_infiniband_PortInfo_P_KeyViolations = -1;
+static int hf_infiniband_PortInfo_Q_KeyViolations = -1;
+static int hf_infiniband_PortInfo_GUIDCap = -1;
+static int hf_infiniband_PortInfo_ClientReregister = -1;
+static int hf_infiniband_PortInfo_SubnetTimeOut = -1;
+static int hf_infiniband_PortInfo_RespTimeValue = -1;
+static int hf_infiniband_PortInfo_LocalPhyErrors = -1;
+static int hf_infiniband_PortInfo_OverrunErrors = -1;
+static int hf_infiniband_PortInfo_MaxCreditHint = -1;
+static int hf_infiniband_PortInfo_LinkRoundTripLatency = -1;
+
+/* P_KeyTable */
+static int hf_infiniband_P_KeyTable_P_KeyTableBlock = -1;
+static int hf_infiniband_P_KeyTable_MembershipType = -1;
+static int hf_infiniband_P_KeyTable_P_KeyBase = -1;
+
+/* SLtoVLMappingTable */
+static int hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits = -1;
+static int hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits = -1;
+
+/* VLArbitrationTable */
+static int hf_infiniband_VLArbitrationTable_VLWeightPairs = -1;
+static int hf_infiniband_VLArbitrationTable_VL = -1;
+static int hf_infiniband_VLArbitrationTable_Weight = -1;
+
+/* LinearForwardingTable */
+static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock = -1;
+static int hf_infiniband_LinearForwardingTable_Port = -1;
+
+/* RandomForwardingTable */
+static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock = -1;
+static int hf_infiniband_RandomForwardingTable_LID = -1;
+static int hf_infiniband_RandomForwardingTable_Valid = -1;
+static int hf_infiniband_RandomForwardingTable_LMC = -1;
+static int hf_infiniband_RandomForwardingTable_Port = -1;
+
+/* MulticastForwardingTable */
+static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock = -1;
+static int hf_infiniband_MulticastForwardingTable_PortMask = -1;
+
+/* SMInfo */
+static int hf_infiniband_SMInfo_GUID = -1;
+static int hf_infiniband_SMInfo_SM_Key = -1;
+static int hf_infiniband_SMInfo_ActCount = -1;
+static int hf_infiniband_SMInfo_Priority = -1;
+static int hf_infiniband_SMInfo_SMState = -1;
+
+/* VendorDiag */
+static int hf_infiniband_VendorDiag_NextIndex = -1;
+static int hf_infiniband_VendorDiag_DiagData = -1;
+
+/* LedInfo */
+static int hf_infiniband_LedInfo_LedMask = -1;
+
+/* LinkSpeedWidthPairsTable */
+static int hf_infiniband_LinkSpeedWidthPairsTable_NumTables = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_PortMask = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen = -1;
+
+/* Attributes for Subnet Administration.
+* Mostly we have "Records" here which are just structures of SM attributes.
+* There are some unique attributes though that we will want to have a structure for. */
+
+/* NodeRecord */
+/* PortInfoRecord */
+/* SLtoVLMappingTableRecord */
+/* SwitchInfoRecord */
+/* LinearForwardingTableRecord */
+/* RandomForwardingTableRecord */
+/* MulticastForwardingTableRecord */
+/* VLArbitrationTableRecord */
+static int hf_infiniband_SA_LID = -1;
+static int hf_infiniband_SA_EndportLID = -1;
+static int hf_infiniband_SA_PortNum = -1;
+static int hf_infiniband_SA_InputPortNum = -1;
+static int hf_infiniband_SA_OutputPortNum = -1;
+static int hf_infiniband_SA_BlockNum_EightBit = -1;
+static int hf_infiniband_SA_BlockNum_NineBit = -1;
+static int hf_infiniband_SA_BlockNum_SixteenBit = -1;
+static int hf_infiniband_SA_Position = -1;
+static int hf_infiniband_SA_Index = -1;
+/* InformInfoRecord */
+static int hf_infiniband_InformInfoRecord_SubscriberGID = -1;
+static int hf_infiniband_InformInfoRecord_Enum = -1;
+
+/* InformInfo */
+static int hf_infiniband_InformInfo_GID = -1;
+static int hf_infiniband_InformInfo_LIDRangeBegin = -1;
+static int hf_infiniband_InformInfo_LIDRangeEnd = -1;
+static int hf_infiniband_InformInfo_IsGeneric = -1;
+static int hf_infiniband_InformInfo_Subscribe = -1;
+static int hf_infiniband_InformInfo_Type = -1;
+static int hf_infiniband_InformInfo_TrapNumberDeviceID = -1;
+static int hf_infiniband_InformInfo_QPN = -1;
+static int hf_infiniband_InformInfo_RespTimeValue = -1;
+static int hf_infiniband_InformInfo_ProducerTypeVendorID = -1;
+
+/* LinkRecord */
+static int hf_infiniband_LinkRecord_FromLID = -1;
+static int hf_infiniband_LinkRecord_FromPort = -1;
+static int hf_infiniband_LinkRecord_ToPort = -1;
+static int hf_infiniband_LinkRecord_ToLID = -1;
+
+/* ServiceRecord */
+static int hf_infiniband_ServiceRecord_ServiceID = -1;
+static int hf_infiniband_ServiceRecord_ServiceGID = -1;
+static int hf_infiniband_ServiceRecord_ServiceP_Key = -1;
+static int hf_infiniband_ServiceRecord_ServiceLease = -1;
+static int hf_infiniband_ServiceRecord_ServiceKey = -1;
+static int hf_infiniband_ServiceRecord_ServiceName = -1;
+static int hf_infiniband_ServiceRecord_ServiceData = -1;
+
+/* ServiceAssociationRecord */
+static int hf_infiniband_ServiceAssociationRecord_ServiceKey = -1;
+static int hf_infiniband_ServiceAssociationRecord_ServiceName = -1;
+
+/* PathRecord */
+static int hf_infiniband_PathRecord_DGID = -1;
+static int hf_infiniband_PathRecord_SGID = -1;
+static int hf_infiniband_PathRecord_DLID = -1;
+static int hf_infiniband_PathRecord_SLID = -1;
+static int hf_infiniband_PathRecord_RawTraffic = -1;
+static int hf_infiniband_PathRecord_FlowLabel = -1;
+static int hf_infiniband_PathRecord_HopLimit = -1;
+static int hf_infiniband_PathRecord_TClass = -1;
+static int hf_infiniband_PathRecord_Reversible = -1;
+static int hf_infiniband_PathRecord_NumbPath = -1;
+static int hf_infiniband_PathRecord_P_Key = -1;
+static int hf_infiniband_PathRecord_SL = -1;
+static int hf_infiniband_PathRecord_MTUSelector = -1;
+static int hf_infiniband_PathRecord_MTU = -1;
+static int hf_infiniband_PathRecord_RateSelector = -1;
+static int hf_infiniband_PathRecord_Rate = -1;
+static int hf_infiniband_PathRecord_PacketLifeTimeSelector = -1;
+static int hf_infiniband_PathRecord_PacketLifeTime = -1;
+static int hf_infiniband_PathRecord_Preference = -1;
+
+/* MCMemberRecord */
+static int hf_infiniband_MCMemberRecord_MGID = -1;
+static int hf_infiniband_MCMemberRecord_PortGID = -1;
+static int hf_infiniband_MCMemberRecord_Q_Key = -1;
+static int hf_infiniband_MCMemberRecord_MLID = -1;
+static int hf_infiniband_MCMemberRecord_MTUSelector = -1;
+static int hf_infiniband_MCMemberRecord_MTU = -1;
+static int hf_infiniband_MCMemberRecord_TClass = -1;
+static int hf_infiniband_MCMemberRecord_P_Key = -1;
+static int hf_infiniband_MCMemberRecord_RateSelector = -1;
+static int hf_infiniband_MCMemberRecord_Rate = -1;
+static int hf_infiniband_MCMemberRecord_PacketLifeTimeSelector = -1;
+static int hf_infiniband_MCMemberRecord_PacketLifeTime = -1;
+static int hf_infiniband_MCMemberRecord_SL = -1;
+static int hf_infiniband_MCMemberRecord_FlowLabel = -1;
+static int hf_infiniband_MCMemberRecord_HopLimit = -1;
+static int hf_infiniband_MCMemberRecord_Scope = -1;
+static int hf_infiniband_MCMemberRecord_JoinState = -1;
+static int hf_infiniband_MCMemberRecord_ProxyJoin = -1;
+
+/* TraceRecord */
+static int hf_infiniband_TraceRecord_GIDPrefix = -1;
+static int hf_infiniband_TraceRecord_IDGeneration = -1;
+static int hf_infiniband_TraceRecord_NodeType = -1;
+static int hf_infiniband_TraceRecord_NodeID = -1;
+static int hf_infiniband_TraceRecord_ChassisID = -1;
+static int hf_infiniband_TraceRecord_EntryPortID = -1;
+static int hf_infiniband_TraceRecord_ExitPortID = -1;
+static int hf_infiniband_TraceRecord_EntryPort = -1;
+static int hf_infiniband_TraceRecord_ExitPort = -1;
+
+/* MultiPathRecord */
+static int hf_infiniband_MultiPathRecord_RawTraffic = -1;
+static int hf_infiniband_MultiPathRecord_FlowLabel = -1;
+static int hf_infiniband_MultiPathRecord_HopLimit = -1;
+static int hf_infiniband_MultiPathRecord_TClass = -1;
+static int hf_infiniband_MultiPathRecord_Reversible = -1;
+static int hf_infiniband_MultiPathRecord_NumbPath = -1;
+static int hf_infiniband_MultiPathRecord_P_Key = -1;
+static int hf_infiniband_MultiPathRecord_SL = -1;
+static int hf_infiniband_MultiPathRecord_MTUSelector = -1;
+static int hf_infiniband_MultiPathRecord_MTU = -1;
+static int hf_infiniband_MultiPathRecord_RateSelector = -1;
+static int hf_infiniband_MultiPathRecord_Rate = -1;
+static int hf_infiniband_MultiPathRecord_PacketLifeTimeSelector = -1;
+static int hf_infiniband_MultiPathRecord_PacketLifeTime = -1;
+static int hf_infiniband_MultiPathRecord_IndependenceSelector = -1;
+static int hf_infiniband_MultiPathRecord_GIDScope = -1;
+static int hf_infiniband_MultiPathRecord_SGIDCount = -1;
+static int hf_infiniband_MultiPathRecord_DGIDCount = -1;
+static int hf_infiniband_MultiPathRecord_SDGID = -1;
+
+/* Notice */
+static int hf_infiniband_Notice_IsGeneric = -1;
+static int hf_infiniband_Notice_Type = -1;
+static int hf_infiniband_Notice_ProducerTypeVendorID = -1;
+static int hf_infiniband_Notice_TrapNumberDeviceID = -1;
+static int hf_infiniband_Notice_IssuerLID = -1;
+static int hf_infiniband_Notice_NoticeToggle = -1;
+static int hf_infiniband_Notice_NoticeCount = -1;
+static int hf_infiniband_Notice_DataDetails = -1;
+static int hf_infiniband_Notice_IssuerGID = -1;
+static int hf_infiniband_Notice_ClassTrapSpecificData = -1;
+
+/* Notice DataDetails and ClassTrapSpecific Data for certain traps
+* Note that traps reuse many fields, so they are only declared once under the first trap that they appear.
+* There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */
+
+/* Parse DataDetails for a given Trap */
+static void parse_NoticeDataDetails(proto_tree*, tvbuff_t*, gint *offset, guint16 trapNumber);
+
+/* Traps 64,65,66,67 */
+static int hf_infiniband_Trap_GIDADDR = -1;
+
+/* Traps 68,69 */
+/* DataDetails */
+static int hf_infiniband_Trap_COMP_MASK = -1;
+static int hf_infiniband_Trap_WAIT_FOR_REPATH = -1;
+/* ClassTrapSpecificData */
+static int hf_infiniband_Trap_PATH_REC = -1;
+
+/* Trap 128 */
+static int hf_infiniband_Trap_LIDADDR = -1;
+
+/* Trap 129, 130, 131 */
+static int hf_infiniband_Trap_PORTNO = -1;
+
+/* Trap 144 */
+static int hf_infiniband_Trap_OtherLocalChanges = -1;
+static int hf_infiniband_Trap_CAPABILITYMASK = -1;
+static int hf_infiniband_Trap_LinkSpeecEnabledChange = -1;
+static int hf_infiniband_Trap_LinkWidthEnabledChange = -1;
+static int hf_infiniband_Trap_NodeDescriptionChange = -1;
+
+/* Trap 145 */
+static int hf_infiniband_Trap_SYSTEMIMAGEGUID = -1;
+
+/* Trap 256 */
+static int hf_infiniband_Trap_DRSLID = -1;
+static int hf_infiniband_Trap_METHOD = -1;
+static int hf_infiniband_Trap_ATTRIBUTEID = -1;
+static int hf_infiniband_Trap_ATTRIBUTEMODIFIER = -1;
+static int hf_infiniband_Trap_MKEY = -1;
+static int hf_infiniband_Trap_DRNotice = -1;
+static int hf_infiniband_Trap_DRPathTruncated = -1;
+static int hf_infiniband_Trap_DRHopCount = -1;
+static int hf_infiniband_Trap_DRNoticeReturnPath = -1;
+
+/* Trap 257, 258 */
+static int hf_infiniband_Trap_LIDADDR1 = -1;
+static int hf_infiniband_Trap_LIDADDR2 = -1;
+static int hf_infiniband_Trap_KEY = -1;
+static int hf_infiniband_Trap_SL = -1;
+static int hf_infiniband_Trap_QP1 = -1;
+static int hf_infiniband_Trap_QP2 = -1;
+static int hf_infiniband_Trap_GIDADDR1 = -1;
+static int hf_infiniband_Trap_GIDADDR2 = -1;
+
+/* Trap 259 */
+static int hf_infiniband_Trap_DataValid = -1;
+static int hf_infiniband_Trap_PKEY = -1;
+static int hf_infiniband_Trap_SWLIDADDR = -1;
+
+/* Trap Type/Descriptions for dissection */
+static const value_string Trap_Description[]= {
+ { 64, " (Informational) <GIDADDR> is now in service"},
+ { 65, " (Informational) <GIDADDR> is out of service"},
+ { 66, " (Informational) New Multicast Group with multicast address <GIDADDR> is now created"},
+ { 67, " (Informational) Multicast Group with multicast address <GIDADDR> is now deleted"},
+ { 68, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> are no longer valid"},
+ { 69, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> have been recomputed"},
+ { 128, " (Urgent) Link State of at least one port of switch at <LIDADDR> has changed"},
+ { 129, " (Urgent) Local Link Integrity threshold reached at <LIDADDR><PORTNO>"},
+ { 130, " (Urgent) Excessive Buffer OVerrun threshold reached at <LIDADDR><PORTNO>"},
+ { 131, " (Urgent) Flow Control Update watchdog timer expired at <LIDADDR><PORTNO>"},
+ { 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"},
+ { 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified. New value is <SYSTEMIMAGEGUID>"},
+ { 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"},
+ { 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
+ { 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
+ { 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"}
+};
+
+
+
+
+/* MAD Management Classes
+* Classes from the Common MAD Header
+*
+* Management Class Name Class Description
+* ------------------------------------------------------------------------------------------------------------ */
+#define SUBN_LID_ROUTED 0x01 /* Subnet Management LID Route */
+#define SUBN_DIRECTED_ROUTE 0x81 /* Subnet Management Directed Route */
+#define SUBNADMN 0x03 /* Subnet Administration */
+#define PERF 0x04 /* Performance Management */
+#define BM 0x05 /* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */
+#define DEV_MGT 0x06 /* Device Management */
+#define COM_MGT 0x07 /* Communications Management */
+#define SNMP 0x08 /* SNMP Tunneling (tunneling of the SNMP protocol through the IBA fabric) */
+#define VENDOR_1_START 0x09 /* Start of first Vendor Specific Range */
+#define VENDOR_1_END 0x0F /* End of first Vendor Specific Range */
+#define VENDOR_2_START 0x30 /* Start of second Vendor Specific Range */
+#define VENDOR_2_END 0x4F /* End of the second Vendor Specific Range */
+#define APPLICATION_START 0x10 /* Start of Application Specific Range */
+#define APPLICATION_END 0x2F /* End of Application Specific Range */
/* Link Next Header Values */
#define IBA_GLOBAL 3
#define IP_NON_IBA 1
#define RAW 0
-/* OpCodeValues */
-/* Code Bits [7-5] Connection Type */
-/* [4-0] Message Type */
+/* OpCodeValues
+* Code Bits [7-5] Connection Type
+* [4-0] Message Type
-/* Reliable Connection (RC) */
-/* [7-5] = 000 */
+* Reliable Connection (RC)
+* [7-5] = 000 */
#define RC_SEND_FIRST 0 /*0x00000000 */
#define RC_SEND_MIDDLE 1 /*0x00000001 */
#define RC_SEND_LAST 2 /*0x00000010 */
#define RC_SEND_LAST_INVAL 22 /*0x00010110 */
#define RC_SEND_ONLY_INVAL 23 /*0x00010111 */
-/* Reliable Datagram (RD) */
-/* [7-5] = 010 */
+/* Reliable Datagram (RD)
+* [7-5] = 010 */
#define RD_SEND_FIRST 64 /*0x01000000 */
#define RD_SEND_MIDDLE 65 /*0x01000001 */
#define RD_SEND_LAST 66 /*0x01000010 */
#define RD_FETCH_ADD 84 /*0x01010100 */
#define RD_RESYNC 85 /*0x01010101 */
-/* Unreliable Datagram (UD) */
-/* [7-5] = 011 */
+/* Unreliable Datagram (UD)
+* [7-5] = 011 */
#define UD_SEND_ONLY 100 /*0x01100100 */
#define UD_SEND_ONLY_IMM 101 /*0x01100101 */
-/* Unreliable Connection (UC) */
-/* [7-5] = 001 */
+/* Unreliable Connection (UC)
+* [7-5] = 001 */
#define UC_SEND_FIRST 32 /*0x00100000 */
#define UC_SEND_MIDDLE 33 /*0x00100001 */
#define UC_SEND_LAST 34 /*0x00100010 */
static value_string OpCodeMap[] =
{
- { RC_SEND_FIRST, "Reliable Connection Send First" },
- { RC_SEND_MIDDLE, "Reliable Connection Send Middle"},
- { RC_SEND_LAST, "Reliable Connection Send Last" },
- { RC_SEND_LAST_IMM, "Reliable Connection Send Last Immediate"},
- { RC_SEND_ONLY, "Reliable Connection Send Only"},
- { RC_SEND_ONLY_IMM, "Reliable Connection Send Only Immediate"},
- { RC_RDMA_WRITE_FIRST, "Reliable Connection RDMA Write First" },
- { RC_RDMA_WRITE_MIDDLE, "Reliable Connection RDMA Write Middle"},
- { RC_RDMA_WRITE_LAST, "Reliable Connection RDMA Write Last"},
- { RC_RDMA_WRITE_LAST_IMM, "Reliable Connection RDMA Write Last Immediate " },
- { RC_RDMA_WRITE_ONLY, "Reliable Connection RDMA Write Only" },
- { RC_RDMA_WRITE_ONLY_IMM, "Reliable Connection RDMA Write Only Immediate"},
- { RC_RDMA_READ_REQUEST, "Reliable Connection RDMA Read Request" },
- { RC_RDMA_READ_RESPONSE_FIRST, "Reliable Connection RDMA Read Response First" },
- { RC_RDMA_READ_RESPONSE_MIDDLE, "Reliable Connection RDMA Read Response Middle"},
- { RC_RDMA_READ_RESPONSE_LAST, "Reliable Connection RDMA Read Response Last" },
- { RC_RDMA_READ_RESPONSE_ONLY, "Reliable Connection RDMA Read Response Only"},
- { RC_ACKNOWLEDGE, "Reliable Connection Acknowledge" },
- { RC_ATOMIC_ACKNOWLEDGE, "Reliable Connection Atomic Acknowledge" },
- { RC_CMP_SWAP, "Reliable Connection Compare Swap" },
- { RC_FETCH_ADD, "Reliable Connection Fetch Add"},
- { RC_SEND_LAST_INVAL, "Reliable Connection Send Last Invalidate"},
- { RC_SEND_ONLY_INVAL, "Reliable Connection Send Only Invalidate" },
-
-
- { RD_SEND_FIRST, "Reliable Datagram Send First"},
- { RD_SEND_MIDDLE,"Reliable Datagram Send Middle" },
- { RD_SEND_LAST, "Reliable Datagram Send Last"},
- { RD_SEND_LAST_IMM, "Reliable Datagram Last Immediate" },
- { RD_SEND_ONLY,"Reliable Datagram Send Only"},
- { RD_SEND_ONLY_IMM,"Reliable Datagram Send Only Immediate"},
- { RD_RDMA_WRITE_FIRST,"Reliable Datagram RDMA Write First"},
- { RD_RDMA_WRITE_MIDDLE, "Reliable Datagram RDMA Write Middle"},
- { RD_RDMA_WRITE_LAST,"Reliable Datagram RDMA Write Last"},
- { RD_RDMA_WRITE_LAST_IMM,"Reliable Datagram RDMA Write Last Immediate"},
- { RD_RDMA_WRITE_ONLY,"Reliable Datagram RDMA Write Only"},
- { RD_RDMA_WRITE_ONLY_IMM,"Reliable Datagram RDMA Write Only Immediate"},
- { RD_RDMA_READ_REQUEST,"Reliable Datagram RDMA Read Request"},
- { RD_RDMA_READ_RESPONSE_FIRST,"Reliable Datagram RDMA Read Response First"},
- { RD_RDMA_READ_RESPONSE_MIDDLE,"Reliable Datagram RDMA Read Response Middle"},
- { RD_RDMA_READ_RESPONSE_LAST,"Reliable Datagram RDMA Read Response Last"},
- { RD_RDMA_READ_RESPONSE_ONLY,"Reliable Datagram RDMA Read Response Only"},
- { RD_ACKNOWLEDGE,"Reliable Datagram Acknowledge"},
- { RD_ATOMIC_ACKNOWLEDGE,"Reliable Datagram Atomic Acknowledge"},
- { RD_CMP_SWAP,"Reliable Datagram Compare Swap"},
- { RD_FETCH_ADD, "Reliable Datagram Fetch Add"},
- { RD_RESYNC,"Reliable Datagram RESYNC"},
-
-
- { UD_SEND_ONLY, "Unreliable Datagram Send Only"},
- { UD_SEND_ONLY_IMM, "Unreliable Datagram Send Only Immediate"},
-
-
- { UC_SEND_FIRST,"Unreliable Connection Send First"},
- { UC_SEND_MIDDLE,"Unreliable Connection Send Middle"},
- { UC_SEND_LAST,"Unreliable Connection Send Last"},
- { UC_SEND_LAST_IMM,"Unreliable Connection Send Last Immediate"},
- { UC_SEND_ONLY,"Unreliable Connection Send Only"},
- { UC_SEND_ONLY_IMM,"Unreliable Connection Send Only Immediate"},
- { UC_RDMA_WRITE_FIRST,"Unreliable Connection RDMA Write First"},
- { UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle"},
- { UC_RDMA_WRITE_LAST,"Unreliable Connection RDMA Write Last"},
- { UC_RDMA_WRITE_LAST_IMM,"Unreliable Connection RDMA Write Last Immediate"},
- { UC_RDMA_WRITE_ONLY,"Unreliable Connection RDMA Write Only"},
- { UC_RDMA_WRITE_ONLY_IMM,"Unreliable Connection RDMA Write Only Immediate"},
- { 0, NULL }
-
-};
-
-
-
-/* Header Ordering Based on OPCODES */
-/* These are simply an enumeration of the possible header combinations defined by the IB Spec. */
-/* These enumerations */
-/* #DEFINE [HEADER_ORDER] [ENUM] */
-/* __________________________________ */
+ { RC_SEND_FIRST, "RC Send First " },
+ { RC_SEND_MIDDLE, "RC Send Middle "},
+ { RC_SEND_LAST, "RC Send Last " },
+ { RC_SEND_LAST_IMM, "RC Send Last Immediate "},
+ { RC_SEND_ONLY, "RC Send Only "},
+ { RC_SEND_ONLY_IMM, "RC Send Only Immediate "},
+ { RC_RDMA_WRITE_FIRST, "RC RDMA Write First " },
+ { RC_RDMA_WRITE_MIDDLE, "RC RDMA Write Middle "},
+ { RC_RDMA_WRITE_LAST, "RC RDMA Write Last "},
+ { RC_RDMA_WRITE_LAST_IMM, "RC RDMA Write Last Immediate " },
+ { RC_RDMA_WRITE_ONLY, "RC RDMA Write Only " },
+ { RC_RDMA_WRITE_ONLY_IMM, "RC RDMA Write Only Immediate "},
+ { RC_RDMA_READ_REQUEST, "RC RDMA Read Request " },
+ { RC_RDMA_READ_RESPONSE_FIRST, "RC RDMA Read Response First " },
+ { RC_RDMA_READ_RESPONSE_MIDDLE, "RC RDMA Read Response Middle "},
+ { RC_RDMA_READ_RESPONSE_LAST, "RC RDMA Read Response Last " },
+ { RC_RDMA_READ_RESPONSE_ONLY, "RC RDMA Read Response Only "},
+ { RC_ACKNOWLEDGE, "RC Acknowledge " },
+ { RC_ATOMIC_ACKNOWLEDGE, "RC Atomic Acknowledge " },
+ { RC_CMP_SWAP, "RC Compare Swap " },
+ { RC_FETCH_ADD, "RC Fetch Add "},
+ { RC_SEND_LAST_INVAL, "RC Send Last Invalidate "},
+ { RC_SEND_ONLY_INVAL, "RC Send Only Invalidate " },
+
+
+ { RD_SEND_FIRST, "RD Send First "},
+ { RD_SEND_MIDDLE,"RD Send Middle " },
+ { RD_SEND_LAST, "RD Send Last "},
+ { RD_SEND_LAST_IMM, "RD Last Immediate " },
+ { RD_SEND_ONLY,"RD Send Only "},
+ { RD_SEND_ONLY_IMM,"RD Send Only Immediate "},
+ { RD_RDMA_WRITE_FIRST,"RD RDMA Write First "},
+ { RD_RDMA_WRITE_MIDDLE, "RD RDMA Write Middle "},
+ { RD_RDMA_WRITE_LAST,"RD RDMA Write Last "},
+ { RD_RDMA_WRITE_LAST_IMM,"RD RDMA Write Last Immediate "},
+ { RD_RDMA_WRITE_ONLY,"RD RDMA Write Only "},
+ { RD_RDMA_WRITE_ONLY_IMM,"RD RDMA Write Only Immediate "},
+ { RD_RDMA_READ_REQUEST,"RD RDMA Read Request "},
+ { RD_RDMA_READ_RESPONSE_FIRST,"RD RDMA Read Response First "},
+ { RD_RDMA_READ_RESPONSE_MIDDLE,"RD RDMA Read Response Middle "},
+ { RD_RDMA_READ_RESPONSE_LAST,"RD RDMA Read Response Last "},
+ { RD_RDMA_READ_RESPONSE_ONLY,"RD RDMA Read Response Only "},
+ { RD_ACKNOWLEDGE,"RD Acknowledge "},
+ { RD_ATOMIC_ACKNOWLEDGE,"RD Atomic Acknowledge "},
+ { RD_CMP_SWAP,"RD Compare Swap "},
+ { RD_FETCH_ADD, "RD Fetch Add "},
+ { RD_RESYNC,"RD RESYNC "},
+
+
+ { UD_SEND_ONLY, "UD Send Only "},
+ { UD_SEND_ONLY_IMM, "UD Send Only Immediate "},
+
+
+ { UC_SEND_FIRST,"UC Send First "},
+ { UC_SEND_MIDDLE,"UC Send Middle "},
+ { UC_SEND_LAST,"UC Send Last "},
+ { UC_SEND_LAST_IMM,"UC Send Last Immediate "},
+ { UC_SEND_ONLY,"UC Send Only "},
+ { UC_SEND_ONLY_IMM,"UC Send Only Immediate "},
+ { UC_RDMA_WRITE_FIRST,"UC RDMA Write First"},
+ { UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle "},
+ { UC_RDMA_WRITE_LAST,"UC RDMA Write Last "},
+ { UC_RDMA_WRITE_LAST_IMM,"UC RDMA Write Last Immediate "},
+ { UC_RDMA_WRITE_ONLY,"UC RDMA Write Only "},
+ { UC_RDMA_WRITE_ONLY_IMM,"UC RDMA Write Only Immediate "},
+ { 0, NULL}
+
+};
+
+
+
+/* Header Ordering Based on OPCODES
+* These are simply an enumeration of the possible header combinations defined by the IB Spec.
+* These enumerations
+* #DEFINE [HEADER_ORDER] [ENUM]
+* __________________________________ */
#define RDETH_DETH_PAYLD 0
/* __________________________________ */
#define RDETH_DETH_RETH_PAYLD 1
/* ___________________________________ */
-/* Array of all availavle OpCodes to make matching a bit easier. */
-/* The OpCodes dictate the header sequence following in the packet. */
-/* These arrays tell the dissector which headers must be decoded for the given OpCode. */
+/* Array of all availavle OpCodes to make matching a bit easier.
+* The OpCodes dictate the header sequence following in the packet.
+* These arrays tell the dissector which headers must be decoded for the given OpCode. */
static guint32 opCode_RDETH_DETH_ATOMICETH[] = {
RD_CMP_SWAP,
RD_FETCH_ADD
UC_RDMA_WRITE_LAST
};
-/* It is not necessary to create arrays for these OpCodes since they indicate only one further header. */
-/* We can just decode it directly */
-
-/*static guint32 opCode_DETH_IMMDT_PAYLD[] = { */
-/* UD_SEND_ONLY_IMM */
-/*}; */
-/*static guint32 opCode_DETH_PAYLD[] = { */
-/* UD_SEND_ONLY */
-/*}; */
-/*static guint32 opCode_RDETH_DETH[] = { */
-/* RD_RESYNC */
-/*}; */
-/*static guint32 opCode_RDETH_DETH_RETH[] = { */
-/* RD_RDMA_READ_REQUEST */
-/*}; */
-/*static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = { */
-/* RD_RDMA_WRITE_ONLY_IMM */
-/*}; */
-/*static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = { */
-/* RD_ATOMIC_ACKNOWLEDGE */
-/*}; */
-/*static guint32 opCode_RDETH_AETH[] = { */
-/* RD_ACKNOWLEDGE */
-/*}; */
-/*static guint32 opCode_RDETH_PAYLD[] = { */
-/* RD_RDMA_READ_RESPONSE_MIDDLE */
-/*}; */
-/*static guint32 opCode_AETH_ATOMICACKETH[] = { */
-/* RC_ATOMIC_ACKNOWLEDGE */
-/*}; */
-/*static guint32 opCode_RETH[] = { */
-/* RC_RDMA_READ_REQUEST */
-/*}; */
-/*static guint32 opCode_AETH[] = { */
-/* RC_ACKNOWLEDGE */
-/*}; */
-
-
-/* Field dissector structures. */
-/* For reserved fields, reservedX denotes the reserved field is X bits in length. */
-/* e.g. reserved2 is a reserved field 2 bits in length. */
-/* The third parameter is a filter string associated for this field. */
-/* So for instance, to filter packets for a given virtual lane, */
-/* The filter (infiniband.LRH.vl == 3) or something similar would be used. */
+/* It is not necessary to create arrays for these OpCodes since they indicate only one further header.
+* We can just decode it directly
+
+* static guint32 opCode_DETH_IMMDT_PAYLD[] = {
+* UD_SEND_ONLY_IMM
+* };
+* static guint32 opCode_DETH_PAYLD[] = {
+* UD_SEND_ONLY
+* };
+* static guint32 opCode_RDETH_DETH[] = {
+* RD_RESYNC
+* };
+* static guint32 opCode_RDETH_DETH_RETH[] = {
+* RD_RDMA_READ_REQUEST
+* };
+* static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = {
+* RD_RDMA_WRITE_ONLY_IMM
+* };
+* static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = {
+* RD_ATOMIC_ACKNOWLEDGE
+* };
+* static guint32 opCode_RDETH_AETH[] = {
+* RD_ACKNOWLEDGE
+* };
+* static guint32 opCode_RDETH_PAYLD[] = {
+* RD_RDMA_READ_RESPONSE_MIDDLE
+* };
+* static guint32 opCode_AETH_ATOMICACKETH[] = {
+* RC_ATOMIC_ACKNOWLEDGE
+* };
+* static guint32 opCode_RETH[] = {
+* RC_RDMA_READ_REQUEST
+* };
+* static guint32 opCode_AETH[] = {
+* RC_ACKNOWLEDGE
+* }; */
+
+
+/* Field dissector structures.
+* For reserved fields, reservedX denotes the reserved field is X bits in length.
+* e.g. reserved2 is a reserved field 2 bits in length.
+* The third parameter is a filter string associated for this field.
+* So for instance, to filter packets for a given virtual lane,
+* The filter (infiniband.LRH.vl == 3) or something similar would be used. */
static hf_register_info hf[] = {
{"Hop Limit", "infiniband.grh.hoplmt", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
{&hf_infiniband_source_gid,
- {"Source GID", "infiniband.grh.sgid", FT_BYTES, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ {"Source GID", "infiniband.grh.sgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
{&hf_infiniband_destination_gid,
- {"Destination GID", "infiniband.grh.dgid", FT_BYTES, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ {"Destination GID", "infiniband.grh.dgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
/* Base Transport Header (BTH) */
{"Packet Sequence Number", "infiniband.bth.psn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
+ /* Raw Header (RWH) */
+ {&hf_infiniband_RWH,
+ {"Raw Header", "infiniband.rwh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved16_RWH,
+ {"Reserved (16 bits)", "infiniband.rwh.reserved", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_etype,
+ {"Ethertype", "infiniband.rwh.etype", FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL }
+ },
+
/* Reliable Datagram Extended Transport Header (RDETH) */
{&hf_infiniband_RDETH,
{"Reliable Datagram Extentded Transport Header", "infiniband.rdeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
{"RDMA Extended Transport Header", "infiniband.reth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
},
{&hf_infiniband_virtual_address,
- {"Virtual Address", "infiniband.reth.va", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ {"Virtual Address", "infiniband.reth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
{&hf_infiniband_remote_key,
- {"Remote Key", "infiniband.reth.r_key", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ {"Remote Key", "infiniband.reth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
{&hf_infiniband_dma_length,
- {"DMA Length", "infiniband.reth.dmalen", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ {"DMA Length", "infiniband.reth.dmalen", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
},
/* Atomic Extended Transport Header (AtomicETH) */
{&hf_infiniband_IMMDT,
{"Immediate Data", "infiniband.immdt", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
},
+
/* Invalidate Extended Transport Header (IETH) */
{&hf_infiniband_IETH,
{"RKey", "infiniband.ieth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
},
+
/* Payload */
{&hf_infiniband_payload,
{"Payload", "infiniband.payload", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
/* Unknown or Vendor Specific */
{&hf_infiniband_vendor,
{"Unknown/Vendor Specific Data", "infiniband.vendor", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- }
+ },
+
+ /* MAD Base Header */
+ {&hf_infiniband_MAD,
+ {"MAD (Management Datagram) Common Header", "infiniband.mad", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_base_version,
+ {"Base Version", "infiniband.mad.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_mgmt_class,
+ {"Management Class", "infiniband.mad.mgmtclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_class_version,
+ {"Class Version", "infiniband.mad.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved1,
+ {"Reserved", "infiniband.mad.reserved1", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_method,
+ {"Method", "infiniband.mad.method", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_status,
+ {"Status", "infiniband.mad.status", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_class_specific,
+ {"Class Specific", "infiniband.mad.classspecific", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_transaction_id,
+ {"Transaction ID", "infiniband.mad.transactionid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_attribute_id,
+ {"Attribute ID", "infiniband.mad.attributeid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved16,
+ {"Reserved", "infiniband.mad.reserved16", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_attribute_modifier,
+ {"Attribute Modifier", "infiniband.mad.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_data,
+ {"MAD Data Payload", "infiniband.mad.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP Header */
+ {&hf_infiniband_RMPP,
+ {"RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_version,
+ {"RMPP Type", "infiniband.rmpp.rmppversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_type,
+ {"RMPP Type", "infiniband.rmpp.rmpptype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_r_resp_time,
+ {"R Resp Time", "infiniband.rmpp.rresptime", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_flags,
+ {"RMPP Flags", "infiniband.rmpp.rmppflags", FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_status,
+ {"RMPP Status", "infiniband.rmpp.rmppstatus", FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_data1,
+ {"RMPP Data 1", "infiniband.rmpp.data1", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_data2,
+ {"RMPP Data 2", "infiniband.rmpp.data2", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP Data */
+ {&hf_infiniband_RMPP_DATA,
+ {"RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_segment_number,
+ {"Segment Number", "infiniband.rmpp.segmentnumber", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_payload_length32,
+ {"Payload Length", "infiniband.rmpp.payloadlength", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_transferred_data,
+ {"Transferred Data", "infiniband.rmpp.transferreddata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP ACK */
+ {&hf_infiniband_new_window_last,
+ {"New Window Last", "infiniband.rmpp.newwindowlast", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved220,
+ {"Segment Number", "infiniband.rmpp.reserved220", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP ABORT/STOP */
+ {&hf_infiniband_optional_extended_error_data,
+ {"Optional Extended Error Data", "infiniband.rmpp.extendederrordata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SMP Data (LID Routed) */
+ {&hf_infiniband_SMP_LID,
+ {"Subnet Management Packet (LID Routed)", "infiniband.smplid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_m_key,
+ {"M_Key", "infiniband.smplid.mkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_smp_data,
+ {"SMP Data", "infiniband.smplid.smpdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved1024,
+ {"Reserved (1024 bits)", "infiniband.smplid.reserved1024", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved256,
+ {"Reserved (256 bits)", "infiniband.smplid.reserved256", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SMP Data Directed Route */
+ {&hf_infiniband_SMP_DIRECTED,
+ {"Subnet Management Packet (Directed Route)", "infiniband.smpdirected", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_smp_status,
+ {"Status", "infiniband.smpdirected.smpstatus", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_hop_pointer,
+ {"Hop Pointer", "infiniband.smpdirected.hoppointer", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_hop_count,
+ {"Hop Count", "infiniband.smpdirected.hopcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_dr_slid,
+ {"DrSLID", "infiniband.smpdirected.drslid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_dr_dlid,
+ {"DrDLID", "infiniband.smpdirected.drdlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved28,
+ {"Reserved (224 bits)", "infiniband.smpdirected.reserved28", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_d,
+ {"D (Direction Bit)", "infiniband.smpdirected.d", FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL}
+ },
+ {&hf_infiniband_initial_path,
+ {"Initial Path", "infiniband.smpdirected.initialpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_return_path,
+ {"Return Path", "infiniband.smpdirected.returnpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SA MAD Header */
+ {&hf_infiniband_SA,
+ {"SA Packet (Subnet Administration)", "infiniband.sa.drdlid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_sm_key,
+ {"SM_Key (Verification Key)", "infiniband.sa.smkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_attribute_offset,
+ {"Attribute Offset", "infiniband.sa.attributeoffset", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_component_mask,
+ {"Component Mask", "infiniband.sa.componentmask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_subnet_admin_data,
+ {"Subnet Admin Data", "infiniband.sa.subnetadmindata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* NodeDescription */
+ {&hf_infiniband_NodeDescription_NodeString,
+ {"NodeString", "infiniband.nodedescription.nodestring", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* NodeInfo */
+ {&hf_infiniband_NodeInfo_BaseVersion,
+ {"BaseVersion", "infiniband.nodeinfo.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_ClassVersion,
+ {"ClassVersion", "infiniband.nodeinfo.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_NodeType,
+ {"NodeType", "infiniband.nodeinfo.nodetype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_NumPorts,
+ {"NumPorts", "infiniband.nodeinfo.numports", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_SystemImageGUID,
+ {"SystemImageGUID", "infiniband.nodeinfo.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_NodeGUID,
+ {"NodeGUID", "infiniband.nodeinfo.nodeguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_PortGUID,
+ {"PortGUID", "infiniband.nodeinfo.portguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_PartitionCap,
+ {"PartitionCap", "infiniband.nodeinfo.partitioncap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_DeviceID,
+ {"DeviceID", "infiniband.nodeinfo.deviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_Revision,
+ {"Revision", "infiniband.nodeinfo.revision", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_LocalPortNum,
+ {"LocalPortNum", "infiniband.nodeinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_VendorID,
+ {"VendorID", "infiniband.nodeinfo.vendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SwitchInfo */
+ {&hf_infiniband_SwitchInfo_LinearFDBCap,
+ {"LinearFDBCap", "infiniband.switchinfo.linearfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_RandomFDBCap,
+ {"RandomFDBCap", "infiniband.switchinfo.randomfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_MulticastFDBCap,
+ {"MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_LinearFDBTop,
+ {"LinearFDBTop", "infiniband.switchinfo.linearfdbtop", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_DefaultPort,
+ {"DefaultPort", "infiniband.switchinfo.defaultport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort,
+ {"DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort,
+ {"DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_LifeTimeValue,
+ {"LifeTimeValue", "infiniband.switchinfo.lifetimevalue", FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_PortStateChange,
+ {"PortStateChange", "infiniband.switchinfo.portstatechange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming,
+ {"OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_LIDsPerPort,
+ {"LIDsPerPort", "infiniband.switchinfo.lidsperport", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_PartitionEnforcementCap,
+ {"PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_InboundEnforcementCap,
+ {"InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_OutboundEnforcementCap,
+ {"OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_FilterRawInboundCap,
+ {"FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap", FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_FilterRawOutboundCap,
+ {"FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap", FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_EnhancedPortZero,
+ {"EnhancedPortZero", "infiniband.switchinfo.enhancedportzero", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
+ },
+ /* GUIDInfo */
+ {&hf_infiniband_GUIDInfo_GUIDBlock,
+ {"GUIDBlock", "infiniband.switchinfo.guidblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_GUIDInfo_GUID,
+ {"GUID", "infiniband.switchinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* PortInfo */
+ {&hf_infiniband_PortInfo_M_Key,
+ {"M_Key", "infiniband.portinfo.m_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_GidPrefix,
+ {"GidPrefix", "infiniband.portinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LID,
+ {"LID", "infiniband.portinfo.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MasterSMLID,
+ {"MasterSMLID", "infiniband.portinfo.mastersmlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask,
+ {"CapabilityMask", "infiniband.portinfo.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Capability Mask Flags */
+ {&hf_infiniband_PortInfo_CapabilityMask_SM,
+ {"SM", "infiniband.portinfo.capabilitymask.issm", FT_UINT32, BASE_HEX, NULL, 0x0000002, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_NoticeSupported,
+ {"NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported", FT_UINT32, BASE_HEX, NULL, 0x0000004, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_TrapSupported,
+ {"TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported", FT_UINT32, BASE_HEX, NULL, 0x0000008, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported,
+ {"OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported", FT_UINT32, BASE_HEX, NULL, 0x0000010, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported,
+ {"AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported", FT_UINT32, BASE_HEX, NULL, 0x0000020, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported,
+ {"SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported", FT_UINT32, BASE_HEX, NULL, 0x0000040, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM,
+ {"MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000080, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM,
+ {"PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000100, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported,
+ {"LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported", FT_UINT32, BASE_HEX, NULL, 0x0000200, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SMdisabled,
+ {"SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled", FT_UINT32, BASE_HEX, NULL, 0x0000400, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported,
+ {"SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported", FT_UINT32, BASE_HEX, NULL, 0x0000800, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported,
+ {"PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported", FT_UINT32, BASE_HEX, NULL, 0x0001000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported,
+ {"CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0010000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported,
+ {"SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported", FT_UINT32, BASE_HEX, NULL, 0x0020000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_ReinitSupported,
+ {"ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported", FT_UINT32, BASE_HEX, NULL, 0x0040000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported,
+ {"DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0080000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported,
+ {"VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported", FT_UINT32, BASE_HEX, NULL, 0x0100000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported,
+ {"DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0200000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported,
+ {"CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0400000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported,
+ {"BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0800000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported,
+ {"LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported", FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported,
+ {"ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported", FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported,
+ {"OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported,
+ {"LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported", FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL}
+ },
+ /* End Capability Mask Flags */
+ {&hf_infiniband_PortInfo_DiagCode,
+ {"DiagCode", "infiniband.portinfo.diagcode", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_M_KeyLeasePeriod,
+ {"M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LocalPortNum,
+ {"LocalPortNum", "infiniband.portinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkWidthEnabled,
+ {"LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkWidthSupported,
+ {"LinkWidthSupported", "infiniband.portinfo.linkwidthsupported", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkWidthActive,
+ {"LinkWidthActive", "infiniband.portinfo.linkwidthactive", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkSpeedSupported,
+ {"LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PortState,
+ {"PortState", "infiniband.portinfo.portstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PortPhysicalState,
+ {"PortPhysicalState", "infiniband.portinfo.portphysicalstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkDownDefaultState,
+ {"LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_M_KeyProtectBits,
+ {"M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LMC,
+ {"LMC", "infiniband.portinfo.lmc", FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkSpeedActive,
+ {"LinkSpeedActive", "infiniband.portinfo.linkspeedactive", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkSpeedEnabled,
+ {"LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_NeighborMTU,
+ {"NeighborMTU", "infiniband.portinfo.neighbormtu", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MasterSMSL,
+ {"MasterSMSL", "infiniband.portinfo.mastersmsl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLCap,
+ {"VLCap", "infiniband.portinfo.vlcap", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_InitType,
+ {"InitType", "infiniband.portinfo.inittype", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLHighLimit,
+ {"VLHighLimit", "infiniband.portinfo.vlhighlimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLArbitrationHighCap,
+ {"VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLArbitrationLowCap,
+ {"VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_InitTypeReply,
+ {"InitTypeReply", "infiniband.portinfo.inittypereply", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MTUCap,
+ {"MTUCap", "infiniband.portinfo.mtucap", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLStallCount,
+ {"VLStallCount", "infiniband.portinfo.vlstallcount", FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_HOQLife,
+ {"HOQLife", "infiniband.portinfo.hoqlife", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_OperationalVLs,
+ {"OperationalVLs", "infiniband.portinfo.operationalvls", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PartitionEnforcementInbound,
+ {"PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PartitionEnforcementOutbound,
+ {"PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_FilterRawInbound,
+ {"FilterRawInbound", "infiniband.portinfo.filterrawinbound", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_FilterRawOutbound,
+ {"FilterRawOutbound", "infiniband.portinfo.filterrawoutbound", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_M_KeyViolations,
+ {"M_KeyViolations", "infiniband.portinfo.m_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_P_KeyViolations,
+ {"P_KeyViolations", "infiniband.portinfo.p_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_Q_KeyViolations,
+ {"Q_KeyViolations", "infiniband.portinfo.q_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_GUIDCap,
+ {"GUIDCap", "infiniband.portinfo.guidcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_ClientReregister,
+ {"ClientReregister", "infiniband.portinfo.clientreregister", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_SubnetTimeOut,
+ {"SubnetTimeOut", "infiniband.portinfo.subnettimeout", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_RespTimeValue,
+ {"RespTimeValue", "infiniband.portinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LocalPhyErrors,
+ {"LocalPhyErrors", "infiniband.portinfo.localphyerrors", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_OverrunErrors,
+ {"OverrunErrors", "infiniband.portinfo.overrunerrors", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MaxCreditHint,
+ {"MaxCreditHint", "infiniband.portinfo.maxcredithint", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkRoundTripLatency,
+ {"LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* P_KeyTable */
+ {&hf_infiniband_P_KeyTable_P_KeyTableBlock,
+ {"P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_P_KeyTable_MembershipType,
+ {"MembershipType", "infiniband.p_keytable.membershiptype", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_P_KeyTable_P_KeyBase,
+ {"P_KeyBase", "infiniband.p_keytable.p_keybase", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ /* SLtoVLMappingTable */
+ {&hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits,
+ {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits,
+ {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ /* VLArbitrationTable */
+ {&hf_infiniband_VLArbitrationTable_VLWeightPairs,
+ {"VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ {&hf_infiniband_VLArbitrationTable_VL,
+ {"VL", "infiniband.vlarbitrationtable.vl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_VLArbitrationTable_Weight,
+ {"Weight", "infiniband.vlarbitrationtable.weight", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* LinearForwardingTable */
+ {&hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock,
+ {"LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_LinearForwardingTable_Port,
+ {"Port", "infiniband.linearforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RandomForwardingTable */
+ {&hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock,
+ {"RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_LID,
+ {"LID", "infiniband.randomforwardingtable.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_Valid,
+ {"Valid", "infiniband.randomforwardingtable.valid", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_LMC,
+ {"LMC", "infiniband.randomforwardingtable.lmc", FT_UINT16, BASE_HEX, NULL, 0x70, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_Port,
+ {"Port", "infiniband.randomforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* MulticastForwardingTable */
+ {&hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock ,
+ {"MulticastForwardingTableBlock ", "infiniband.multicastforwardingtable.multicastforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MulticastForwardingTable_PortMask,
+ {"PortMask", "infiniband.multicastforwardingtable.portmask", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SMInfo */
+ {&hf_infiniband_SMInfo_GUID,
+ {"GUID", "infiniband.sminfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_SM_Key,
+ {"SM_Key", "infiniband.sminfo.sm_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_ActCount,
+ {"ActCount", "infiniband.sminfo.actcount", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_Priority,
+ {"Priority", "infiniband.sminfo.priority", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_SMState,
+ {"SMState", "infiniband.sminfo.smstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ /* VendorDiag */
+ {&hf_infiniband_VendorDiag_NextIndex,
+ {"NextIndex", "infiniband.vendordiag.nextindex", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_VendorDiag_DiagData,
+ {"DiagData", "infiniband.vendordiag.diagdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* LedInfo */
+ {&hf_infiniband_LedInfo_LedMask,
+ {"LedMask", "infiniband.ledinfo.ledmask", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ /* LinkSpeedWidthPairsTable */
+ {&hf_infiniband_LinkSpeedWidthPairsTable_NumTables,
+ {"NumTables", "infiniband.linkspeedwidthpairstable.numtables", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_PortMask,
+ {"PortMask", "infiniband.linkspeedwidthpairstable.portmask", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive,
+ {"Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive,
+ {"Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen,
+ {"Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ /* NodeRecord */
+ /* PortInfoRecord */
+ /* SLtoVLMappingTableRecord */
+ /* SwitchInfoRecord */
+ /* LinearForwardingTableRecord */
+ /* RandomForwardingTableRecord */
+ /* MulticastForwardingTableRecord */
+ /* VLArbitrationTableRecord */
+ {&hf_infiniband_SA_LID,
+ {"LID", "infiniband.sa.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_EndportLID,
+ {"EndportLID", "infiniband.sa.endportlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_PortNum,
+ {"PortNum", "infiniband.sa.portnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_InputPortNum ,
+ {"InputPortNum ", "infiniband.sa.inputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_OutputPortNum,
+ {"OutputPortNum", "infiniband.sa.outputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_BlockNum_EightBit,
+ {"BlockNum_EightBit", "infiniband.sa.blocknum_eightbit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_BlockNum_NineBit,
+ {"BlockNum_NineBit", "infiniband.sa.blocknum_ninebit", FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_BlockNum_SixteenBit,
+ {"BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_Position,
+ {"Position", "infiniband.sa.position", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_Index,
+ {"Index", "infiniband.sa.index", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* InformInfoRecord */
+ {&hf_infiniband_InformInfoRecord_SubscriberGID,
+ {"SubscriberGID", "infiniband.informinforecord.subscribergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfoRecord_Enum,
+ {"Enum", "infiniband.informinforecord.enum", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* InformInfo */
+ {&hf_infiniband_InformInfo_GID,
+ {"GID", "infiniband.informinfo.gid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_LIDRangeBegin,
+ {"LIDRangeBegin", "infiniband.informinfo.lidrangebegin", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_LIDRangeEnd,
+ {"LIDRangeEnd", "infiniband.informinfo.lidrangeend", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_IsGeneric,
+ {"IsGeneric", "infiniband.informinfo.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_Subscribe,
+ {"Subscribe", "infiniband.informinfo.subscribe", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_Type,
+ {"Type", "infiniband.informinfo.type", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_TrapNumberDeviceID,
+ {"TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_QPN,
+ {"QPN", "infiniband.informinfo.qpn", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_RespTimeValue,
+ {"RespTimeValue", "infiniband.informinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_ProducerTypeVendorID,
+ {"ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* LinkRecord */
+ {&hf_infiniband_LinkRecord_FromLID,
+ {"FromLID", "infiniband.linkrecord.fromlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkRecord_FromPort,
+ {"FromPort", "infiniband.linkrecord.fromport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkRecord_ToPort,
+ {"ToPort", "infiniband.linkrecord.toport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkRecord_ToLID,
+ {"ToLID", "infiniband.linkrecord.tolid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* ServiceRecord */
+ {&hf_infiniband_ServiceRecord_ServiceID,
+ {"ServiceID", "infiniband.linkrecord.serviceid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceGID,
+ {"ServiceGID", "infiniband.linkrecord.servicegid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceP_Key,
+ {"ServiceP_Key", "infiniband.linkrecord.servicep_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceLease,
+ {"ServiceLease", "infiniband.linkrecord.servicelease", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceKey,
+ {"ServiceKey", "infiniband.linkrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceName,
+ {"ServiceName", "infiniband.linkrecord.servicename", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceData,
+ {"ServiceData", "infiniband.linkrecord.servicedata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* ServiceAssociationRecord */
+ {&hf_infiniband_ServiceAssociationRecord_ServiceKey,
+ {"ServiceKey", "infiniband.serviceassociationrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceAssociationRecord_ServiceName,
+ {"ServiceName", "infiniband.serviceassociationrecord.servicename", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* PathRecord */
+ {&hf_infiniband_PathRecord_DGID,
+ {"DGID", "infiniband.pathrecord.dgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_SGID,
+ {"SGID", "infiniband.pathrecord.sgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_DLID,
+ {"DLID", "infiniband.pathrecord.dlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_SLID,
+ {"SLID", "infiniband.pathrecord.slid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_RawTraffic,
+ {"RawTraffic", "infiniband.pathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_FlowLabel,
+ {"FlowLabel", "infiniband.pathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0xFFFFF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_HopLimit,
+ {"HopLimit", "infiniband.pathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_TClass,
+ {"TClass", "infiniband.pathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_Reversible,
+ {"Reversible", "infiniband.pathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_NumbPath,
+ {"NumbPath", "infiniband.pathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_P_Key,
+ {"P_Key", "infiniband.pathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_SL,
+ {"SL", "infiniband.pathrecord.sl", FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_MTUSelector,
+ {"MTUSelector", "infiniband.pathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_MTU,
+ {"MTU", "infiniband.pathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_RateSelector,
+ {"RateSelector", "infiniband.pathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_Rate,
+ {"Rate", "infiniband.pathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_PacketLifeTimeSelector,
+ {"PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_PacketLifeTime,
+ {"PacketLifeTime", "infiniband.pathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_Preference,
+ {"Preference", "infiniband.pathrecord.preference", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* MCMemberRecord */
+ {&hf_infiniband_MCMemberRecord_MGID,
+ {"MGID", "infiniband.mcmemberrecord.mgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_PortGID,
+ {"PortGID", "infiniband.mcmemberrecord.portgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_Q_Key,
+ {"Q_Key", "infiniband.mcmemberrecord.q_key", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_MLID,
+ {"MLID", "infiniband.mcmemberrecord.mlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_MTUSelector,
+ {"MTUSelector", "infiniband.mcmemberrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_MTU,
+ {"MTU", "infiniband.mcmemberrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_TClass,
+ {"TClass", "infiniband.mcmemberrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_P_Key,
+ {"P_Key", "infiniband.mcmemberrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_RateSelector,
+ {"RateSelector", "infiniband.mcmemberrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_Rate,
+ {"Rate", "infiniband.mcmemberrecord.rate", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_PacketLifeTimeSelector,
+ {"PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_PacketLifeTime,
+ {"PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_SL,
+ {"SL", "infiniband.mcmemberrecord.sl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_FlowLabel,
+ {"FlowLabel", "infiniband.mcmemberrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_HopLimit,
+ {"HopLimit", "infiniband.mcmemberrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_Scope,
+ {"Scope", "infiniband.mcmemberrecord.scope", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_JoinState,
+ {"JoinState", "infiniband.mcmemberrecord.joinstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_ProxyJoin,
+ {"ProxyJoin", "infiniband.mcmemberrecord.proxyjoin", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
+ },
+ /* MultiPathRecord */
+ {&hf_infiniband_MultiPathRecord_RawTraffic,
+ {"RawTraffic", "infiniband.multipathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_FlowLabel,
+ {"FlowLabel", "infiniband.multipathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_HopLimit,
+ {"HopLimit", "infiniband.multipathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_TClass,
+ {"TClass", "infiniband.multipathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_Reversible,
+ {"Reversible", "infiniband.multipathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_NumbPath,
+ {"NumbPath", "infiniband.multipathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_P_Key,
+ {"P_Key", "infiniband.multipathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_SL,
+ {"SL", "infiniband.multipathrecord.sl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_MTUSelector,
+ {"MTUSelector", "infiniband.multipathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_MTU,
+ {"MTU", "infiniband.multipathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_RateSelector,
+ {"RateSelector", "infiniband.multipathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_Rate,
+ {"Rate", "infiniband.multipathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_PacketLifeTimeSelector,
+ {"PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_PacketLifeTime,
+ {"PacketLifeTime", "infiniband.multipathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_IndependenceSelector,
+ {"IndependenceSelector", "infiniband.multipathrecord.independenceselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_GIDScope,
+ {"GIDScope", "infiniband.multipathrecord.gidscope", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_SGIDCount,
+ {"SGIDCount", "infiniband.multipathrecord.sgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_DGIDCount,
+ {"DGIDCount", "infiniband.multipathrecord.dgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_SDGID,
+ {"SDGID", "infiniband.multipathrecord.sdgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Notice */
+ {&hf_infiniband_Notice_IsGeneric,
+ {"IsGeneric", "infiniband.notice.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_Type,
+ {"Type", "infiniband.notice.type", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_ProducerTypeVendorID,
+ {"ProducerTypeVendorID", "infiniband.notice.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_TrapNumberDeviceID,
+ {"TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_IssuerLID,
+ {"IssuerLID", "infiniband.notice.issuerlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_NoticeToggle,
+ {"NoticeToggle", "infiniband.notice.noticetoggle", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_NoticeCount,
+ {"NoticeCount", "infiniband.notice.noticecount", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_DataDetails,
+ {"DataDetails", "infiniband.notice.datadetails", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_IssuerGID,
+ {"IssuerGID", "infiniband.notice.issuergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_ClassTrapSpecificData,
+ {"ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Traps 64,65,66,67 */
+ {&hf_infiniband_Trap_GIDADDR,
+ {"GIDADDR", "infiniband.trap.gidaddr", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Traps 68,69 */
+ {&hf_infiniband_Trap_COMP_MASK,
+ {"COMP_MASK", "infiniband.trap.comp_mask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_WAIT_FOR_REPATH,
+ {"WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_PATH_REC,
+ {"PATH_REC", "infiniband.trap.path_rec", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Trap 128 */
+ {&hf_infiniband_Trap_LIDADDR,
+ {"LIDADDR", "infiniband.trap.lidaddr", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Trap 129, 130, 131 */
+ {&hf_infiniband_Trap_PORTNO,
+ {"PORTNO", "infiniband.trap.portno", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Trap 144 */
+ {&hf_infiniband_Trap_OtherLocalChanges,
+ {"OtherLocalChanges", "infiniband.trap.otherlocalchanges", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_CAPABILITYMASK,
+ {"CAPABILITYMASK", "infiniband.trap.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_LinkSpeecEnabledChange,
+ {"LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_LinkWidthEnabledChange,
+ {"LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_NodeDescriptionChange,
+ {"NodeDescriptionChange", "infiniband.trap.nodedescriptionchange", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 145 */
+ {&hf_infiniband_Trap_SYSTEMIMAGEGUID,
+ {"SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 256 */
+ {&hf_infiniband_Trap_DRSLID,
+ {"DRSLID", "infiniband.trap.drslid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_METHOD,
+ {"METHOD", "infiniband.trap.method", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_ATTRIBUTEID,
+ {"ATTRIBUTEID", "infiniband.trap.attributeid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_ATTRIBUTEMODIFIER,
+ {"ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_MKEY,
+ {"MKEY", "infiniband.trap.mkey", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRNotice,
+ {"DRNotice", "infiniband.trap.drnotice", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRPathTruncated,
+ {"DRPathTruncated", "infiniband.trap.drpathtruncated", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRHopCount,
+ {"DRHopCount", "infiniband.trap.drhopcount", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRNoticeReturnPath,
+ {"DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath", FT_BYTES, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 257, 258 */
+ {&hf_infiniband_Trap_LIDADDR1,
+ {"LIDADDR1", "infiniband.trap.lidaddr1", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_LIDADDR2,
+ {"LIDADDR2", "infiniband.trap.lidaddr2", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_KEY,
+ {"KEY", "infiniband.trap.key", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_SL,
+ {"SL", "infiniband.trap.sl", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_QP1,
+ {"QP1", "infiniband.trap.qp1", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_QP2,
+ {"QP2", "infiniband.trap.qp2", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_GIDADDR1,
+ {"GIDADDR1", "infiniband.trap.gidaddr1", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_GIDADDR2,
+ {"GIDADDR2", "infiniband.trap.gidaddr2", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 259 */
+ {&hf_infiniband_Trap_DataValid,
+ {"DataValid", "infiniband.trap.datavalid", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_PKEY,
+ {"PKEY", "infiniband.trap.pkey", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_SWLIDADDR,
+ {"SWLIDADDR", "infiniband.trap.swlidaddr", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ }
};
+/* Array to hold expansion options between dissections */
static gint *ett[] = {
- &ett_infiniband
+ &ett_infiniband,
+ &ett_all_headers,
+ &ett_lrh,
+ &ett_grh,
+ &ett_bth,
+ &ett_rwh,
+ &ett_rawdata,
+ &ett_rdeth,
+ &ett_deth,
+ &ett_reth,
+ &ett_atomiceth,
+ &ett_aeth,
+ &ett_atomicacketh,
+ &ett_immdt,
+ &ett_ieth,
+ &ett_payload,
+ &ett_vendor,
+ &ett_subn_lid_routed,
+ &ett_subn_directed_route,
+ &ett_subnadmin,
+ &ett_mad,
+ &ett_rmpp,
+ &ett_subm_attribute,
+ &ett_suba_attribute,
+ &ett_datadetails,
+ &ett_noticestraps,
+ &ett_nodedesc,
+ &ett_nodeinfo,
+ &ett_switchinfo,
+ &ett_guidinfo,
+ &ett_portinfo,
+ &ett_portinfo_capmask,
+ &ett_pkeytable,
+ &ett_sltovlmapping,
+ &ett_vlarbitrationtable,
+ &ett_linearforwardingtable,
+ &ett_randomforwardingtable,
+ &ett_multicastforwardingtable,
+ &ett_sminfo,
+ &ett_vendordiag,
+ &ett_ledinfo,
+ &ett_linkspeedwidthpairs,
+ &ett_informinfo,
+ &ett_linkrecord,
+ &ett_servicerecord,
+ &ett_pathrecord,
+ &ett_mcmemberrecord,
+ &ett_tracerecord,
+ &ett_multipathrecord,
+ &ett_serviceassocrecord
};
git.samba.org / metze / wireshark / wip.git / commitdiff